DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Arp5

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001262697.1 Gene:Arp5 / 42173 FlyBaseID:FBgn0038576 Length:648 Species:Drosophila melanogaster


Alignment Length:207 Identity:44/207 - (21%)
Similarity:81/207 - (39%) Gaps:70/207 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 TESVLEDIKVRTCFVTTMERAKARANGDE------------------NQPTPAPDVDYIVSDNDA 233
            |.:..|.:::.:......:|.|  |||:|                  |:.....|.|   :||:.
  Fly   420 THAAQERMRIISSLAKNEKRRK--ANGEEEDDGFGMNDNDWDVYKRINRYNDDSDSD---ADNEK 479

  Fly   234 VIQVPGLLR--------------ESA---YEIMFEASNERDSLPHLILR-SILDCT--------- 271
            ::|...:|.              :||   |::.|...|.|  :|.::.: |::.|:         
  Fly   480 LMQFDKILNHYDANTDGNSNVPPQSAAENYQLHFGVENIR--VPEVLFQPSMIGCSEAGLAELIA 542

  Fly   272 -------LDVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFFNAVG 329
                   ...::.|||.|:|.||.:..:||..||.:||..:   .||       :.:|..:.: .
  Fly   543 FVLKLFPAAEQQRLVEHVYLTGGCAQFKGLKERLIKELMEM---RPF-------QSKFAIYES-D 596

  Fly   330 KQNFTAWLGGAL 341
            :...:||||..:
  Fly   597 EPTLSAWLGACV 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 44/204 (22%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 44/207 (21%)
Arp5NP_001262697.1 COG5277 1..637 CDD:227602 44/207 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.