DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Act79B

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001262200.1 Gene:Act79B / 40444 FlyBaseID:FBgn0000045 Length:376 Species:Drosophila melanogaster


Alignment Length:391 Identity:86/391 - (21%)
Similarity:162/391 - (41%) Gaps:66/391 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEV-------VMTTTGIR----------KR----- 51
            :|...:|:|.|:...|.|||.:..||.:.|:.|       ||...|.:          ||     
  Fly     4 EEASALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDCYVGDEAQSKRGILSL 68

  Fly    52 --------LFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFV 108
                    :.::|..|:::..       .|:..|.|:|:|...:|.|........||.:.:::|.
  Fly    69 KYPIEHGIITNWDDMEKVWHH-------TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 126

  Fly   109 HFDVSSVLFVPVH-LIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEI 172
            .|: |..::|.:. :::|......|.:|:|.|...:..:|::.|..:..|.......|..:...:
  Fly   127 TFN-SPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYL 190

  Fly   173 KRQLVESGVKESLLTE-SVLEDIKVRTCFVT---TMERAKARANGDENQPTPAPDVDYIVSDNDA 233
            .:.|.|.|...:...| .::.|||.:.|:|.   ..|.|.|.|:....:....||...|...|: 
  Fly   191 MKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNE- 254

  Fly   234 VIQVPGLLRESAYEIMFEAS---NERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLL 295
                    |....|.:|:.|   .|...:...:.:||:.|.:|:|:.|..:..|.||.:|..|:.
  Fly   255 --------RFRTPEALFQPSFLGMESCGIHETVYQSIMKCDVDIRKDLYANNVLSGGTTMYPGIA 311

  Fly   296 ARLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLK 360
            .|:::|:..|..          ..::.|.. |..::.::.|:||::..:....|...:.|:.|.:
  Fly   312 DRMQKEITALAP----------STIKIKII-APPERKYSVWIGGSILASLSTFQQMWISKQEYDE 365

  Fly   361 S 361
            |
  Fly   366 S 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 80/366 (22%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 85/388 (22%)
Act79BNP_001262200.1 PTZ00281 1..376 CDD:173506 86/391 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.