DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and POTEC

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001131143.1 Gene:POTEC / 388468 HGNCID:33894 Length:542 Species:Homo sapiens


Alignment Length:208 Identity:46/208 - (22%)
Similarity:71/208 - (34%) Gaps:58/208 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VENVFGSTVLR-------ETLARVLFVH-FDVSS-------VLFVPVH----------------L 122
            :.:.:|:|.|.       :.:|:.|.:: .|:.|       .|.:.||                |
Human   234 IPDEYGNTTLHYAVHNEDKLMAKALLLYGADIESKNKCGLTPLLLGVHEQKQQVVKFLIKKKANL 298

  Fly   123 IALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQS------YGGSAIHAEIKRQLVESGV 181
            .||.... .|||::.|.....|::.:.....:..:.:|.|      |..|:.|..|...|.:...
Human   299 NALDRYG-RTALILAVCCGSASIVNLLLEQNVDVSSQDLSGQTAREYAVSSHHHVICELLSDYKE 362

  Fly   182 KESLLTES----VLEDIKVRTCFVTTMERAKARANGDEN-QPTPAPDVDYIVSDNDAVIQVPGLL 241
            |:.|...|    ..:|:|:      |.|....|....|| ||........|..|.|         
Human   363 KQMLKISSENSNPEQDLKL------TSEEESQRLKVSENSQPEKMSQEPEINKDCD--------- 412

  Fly   242 RESAYEIMFEASN 254
            ||...||....||
Human   413 REVEEEIKKHGSN 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 46/208 (22%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 46/208 (22%)
POTECNP_001131143.1 ANK 1 138..171
Ank_4 143..193 CDD:290365
ANK 167..292 CDD:238125 10/57 (18%)
ANK 2 172..201
ANK repeat 174..203 CDD:293786
Ank_2 177..269 CDD:289560 7/34 (21%)
ANK repeat 205..236 CDD:293786 0/1 (0%)
ANK 3 205..234 46/208 (22%)
ANK 233..357 CDD:238125 24/123 (20%)
ANK repeat 238..269 CDD:293786 7/30 (23%)
ANK 4 238..267 6/28 (21%)
Ank_2 243..335 CDD:289560 16/92 (17%)
ANK repeat 271..302 CDD:293786 5/30 (17%)
ANK 5 271..300 4/28 (14%)
ANK repeat 304..335 CDD:293786 5/31 (16%)
ANK 6 304..333 5/29 (17%)
ANK 7 337..373 9/35 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 369..494 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.