DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Arp8

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_573251.1 Gene:Arp8 / 32769 FlyBaseID:FBgn0030877 Length:607 Species:Drosophila melanogaster


Alignment Length:344 Identity:65/344 - (18%)
Similarity:108/344 - (31%) Gaps:139/344 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQLVESG-------VKESLLTESVLE 192
            |||:|..:||:..:..|:..:.|....||||..:...:...|.:.|       |:||.:...:|:
  Fly   276 VVDIGAQKTSIACIEDGISQLDARVRLSYGGGDLDQVLLLLLRKCGFPYRECNVQESYVDAHLLD 340

  Fly   193 DIKVRTCFVT-----------------------TME----------------------RAKA--- 209
            ::|.:.|.:.                       |::                      |.||   
  Fly   341 ELKEKFCHLNASVCGAQEKHFNLRKHNGQWLRYTIQVGDEALMAPLALFHTELLNITGRTKAVFT 405

  Fly   210 -----------------------RANGDEN------------QPTP-----APDVDYIVSDNDAV 234
                                   |.||...            ||.|     |.|.:.||.|.|..
  Fly   406 QQAVQDQYDCEDCFDAEYLKETGRKNGVRGGDILQLSTSAGYQPRPQLPVTADDEELIVVDQDET 470

  Fly   235 I---------QVPG--LLRESAYEIMFEASNERDSLP--HLILRSILD-CTLDVRRALVESVFLV 285
            |         |..|  :.....|.     :.:...||  ..|::||.. .:.:.:|.:..|:.||
  Fly   471 ISNCQSQLGAQTAGGQMNSNGCYH-----NGQGLVLPLDQAIIQSINRLSSYETKRKMFGSILLV 530

  Fly   286 GGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQ--FKFFNAVGKQNFTAWLGGALCGATDLI 348
            |..:.:.||.|.|.|.:          :::...|:.  .|..:|    ...||.|.|:....:  
  Fly   531 GSSAKLPGLAAWLEQRI----------SQQVQSEVNVLIKGMDA----GMVAWKGAAIMSVLE-- 579

  Fly   349 QTRSLVKETYLKSEHVPDW 367
                ..:|.::...   ||
  Fly   580 ----SARELWISQN---DW 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 61/315 (19%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 63/342 (18%)
Arp8NP_573251.1 NBD_sugar-kinase_HSP70_actin 202..603 CDD:302596 65/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467795
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.