DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Arp2

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001259621.1 Gene:Arp2 / 32623 FlyBaseID:FBgn0011742 Length:399 Species:Drosophila melanogaster


Alignment Length:351 Identity:79/351 - (22%)
Similarity:128/351 - (36%) Gaps:75/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIRKRLFDYDTPEELYDQLV------------ 66
            ||.|.||.:.|.|:|...:|..|.|:.|.........::.|.:..:...|.|:            
  Fly     9 IVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLHVDDLMVGDEASQLRSLL 73

  Fly    67 ---------------------DFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHF 110
                                 |:  |...|.:.:.|...|.:|.|.....|..||.:..|:|..:
  Fly    74 EVSYPMENGVVRNWDDMCHVWDY--TFGPKKMDIDPTNTKILLTEPPMNPTKNREKMIEVMFEKY 136

  Fly   111 DVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQ 175
            ...|.......::.|....:.:.:|:|.|...|.:.||:....:....:.....|..|...:.:.
  Fly   137 GFDSAYIAIQAVLTLYAQGLISGVVIDSGDGVTHICPVYEEFALPHLTRRLDIAGRDITRYLIKL 201

  Fly   176 LVESG--VKESLLTESVLEDIKVRTCFV---TTMERAKARANGDENQPTPAPDVDYIVSDNDAVI 235
            |:..|  ...|...|:| ..:|.:.|::   ..||:..|       ..|......|.:.|. .||
  Fly   202 LLLRGYAFNHSADFETV-RIMKEKLCYIGYDIEMEQRLA-------LETTVLVESYTLPDG-RVI 257

  Fly   236 QVPGLLRESAYEIMFEASNERDSLPHLI-----------LRSILDCTLDVRRALVESVFLVGGGS 289
            :|.| .|..|.|.:|:        ||||           ..:|....:|:|..|.:.:.|.||.:
  Fly   258 KVGG-ERFEAPEALFQ--------PHLINVEGPGIAELAFNTIQAADIDIRPELYKHIVLSGGST 313

  Fly   290 MVQGLLARLRQELQHLLTEDPFYAER 315
            |..||.:||.:|::.|      |.||
  Fly   314 MYPGLPSRLEREIKQL------YLER 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 79/351 (23%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 79/351 (23%)
Arp2NP_001259621.1 ACTIN 6..393 CDD:214592 79/351 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467826
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.