DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actr1b

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001034117.2 Gene:Actr1b / 316333 RGDID:1307380 Length:376 Species:Rattus norvegicus


Alignment Length:395 Identity:83/395 - (21%)
Similarity:158/395 - (40%) Gaps:69/395 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPIYESVMQEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEV-------VMTTTGIRKRLF----- 53
            |..|:.:..:  |:|:|.|:...|.|||.:..|:...|..|       || ...:...||     
  Rat     1 MESYDIIANQ--PVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVM-AGALEGDLFIGPKA 62

  Fly    54 -------------------DYDTPEELYDQLV--DFLQTIFFKHLLVSPKERKFVLVENVFGSTV 97
                               |::..|.::..:.  |.|||.        .:|...:|.|.....:.
  Rat    63 EEHRGLLTIRYPMEHGVVRDWNDMERIWQYVYSKDQLQTF--------SEEHPVLLTEAPLNPSK 119

  Fly    98 LRETLARVLFVHFDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQS 162
            .||..|.|.|..|:|.::......:::|......|.:|:|.|...|..:|::.|..:..:.....
  Rat   120 NREKAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVD 184

  Fly   163 YGGSAIHAEIKRQLVESGVKESLLTE-SVLEDIKVRTCFVTTMERAKARANGDENQPTPAPDVDY 226
            ..|..:...::..|.:.|.......| .|:..||.|.|:::        .|..:::......|.|
  Rat   185 IAGRDVSRYLRLLLRKEGADFHTSAEFEVVRTIKERACYLS--------INPQKDEALETEKVQY 241

  Fly   227 IVSDNDAVIQVPGLLRESAYEIMFE---ASNERDSLPHLILRSILDCTLDVRRALVESVFLVGGG 288
            .:.|...:...|...|  |.|::|:   ..:|.:.|..::..:|....:|:||.|..::.|.||.
  Rat   242 TLPDGSTLDVGPARFR--APELLFQPDLVGDESEGLHEVLAFAIHKSDMDLRRTLFSNIVLSGGS 304

  Fly   289 SMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSL 353
            ::.:|...||..|::.|..:|          ::.| .:|..::.::.|:||::..:.|..:...:
  Rat   305 TLFKGFGDRLLSEVKKLAPKD----------VKIK-ISAPQERLYSTWIGGSILASLDTFKKMWV 358

  Fly   354 VKETY 358
            .|:.|
  Rat   359 SKKEY 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 77/365 (21%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 81/384 (21%)
Actr1bNP_001034117.2 NBD_sugar-kinase_HSP70_actin 5..376 CDD:418402 81/391 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.