DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actl11

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001019959.2 Gene:Actl11 / 316000 RGDID:1310036 Length:1218 Species:Rattus norvegicus


Alignment Length:393 Identity:97/393 - (24%)
Similarity:159/393 - (40%) Gaps:80/393 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEVVM-----------------------TTTGIRK 50
            |:...||:|.||.:||.|.|.|.:...::|::|.|                       ...|:  
  Rat   867 QKMAAIVIDTGTGFTKCGLAQENHVLSVVPSQVQMLQHPPQGQPQYVVPEHQEGSYSVLNRGV-- 929

  Fly    51 RLFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVSSV 115
             :.|:|..|.|:       |.:|:..|.|.|:|...::.::.......||.:|.:||..|.|.::
  Rat   930 -VSDWDALEVLW-------QHLFYCKLRVQPEEMAVLVADSPISPRTNREKVAEILFERFHVPAM 986

  Fly   116 LFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSG-VQIMAAFKDQSYGGSAIHAEIKRQLVES 179
            ..|...|:.|......|.|||..|:..:.|.|:.:| :..:..::....|...  .:...||:.|
  Rat   987 QTVHQALLTLYAYGRTTGLVVGSGHGTSYVAPIITGDLAPLDTYRLDVAGADL--TDYLAQLLMS 1049

  Fly   180 GVKESLLTESVLEDIKVRTCFV---TTMERAKARANGDENQPTPAPDVDYIVSDNDAVIQVPGLL 241
            | ..|.....::..||...|:|   ||.|.|:   |..:.|      ||:::.|...:  ..|..
  Rat  1050 G-GHSPPKGGIVRQIKEACCYVAMDTTTEMAR---NQSQVQ------VDFVLPDKHVI--TLGSE 1102

  Fly   242 RESAYEIMFEAS----NERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQEL 302
            |....|.:|:.:    |:. .||.|.|.||....:..:..|:.:|.|.||.:::.|...|:||||
  Rat  1103 RFCCPEALFQPNLLGLNQL-GLPQLALLSISRLEVKQQEQLLANVVLEGGSTLINGFPERMRQEL 1166

  Fly   303 QHLLTEDPFYAERFHGELQFKFFNAVGKQN--FTAWLGGALCGATDLIQTRSLVKETYLKSEHVP 365
            ....|                   .:|..:  ..|||||::....|..|:..|.:..|   |...
  Rat  1167 GPGAT-------------------VLGSPHRAVAAWLGGSIMACRDSFQSLWLSRREY---EEEG 1209

  Fly   366 DWS 368
            .|:
  Rat  1210 PWA 1212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 89/361 (25%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 95/387 (25%)
Actl11NP_001019959.2 PHA03247 <200..485 CDD:223021
NBD_sugar-kinase_HSP70_actin 871..1215 CDD:418402 96/389 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D964605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.