DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Act5C

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001014725.1 Gene:Act5C / 31521 FlyBaseID:FBgn0000042 Length:376 Species:Drosophila melanogaster


Alignment Length:390 Identity:83/390 - (21%)
Similarity:157/390 - (40%) Gaps:64/390 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEV-------VMTTTGIR----------KR----- 51
            :|...:|:|.|:...|.|||.:..||.:.|:.|       ||...|.:          ||     
  Fly     4 EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL 68

  Fly    52 --------LFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFV 108
                    :.::|..|:::..       .|:..|.|:|:|...:|.|........||.:.:::|.
  Fly    69 KYPIEHGIVTNWDDMEKIWHH-------TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 126

  Fly   109 HFDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIK 173
            .|:..::......:::|......|.:|:|.|...:..:|::.|..:..|.......|..:...:.
  Fly   127 TFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLM 191

  Fly   174 RQLVESGVKESLLTE-SVLEDIKVRTCFVT---TMERAKARANGDENQPTPAPDVDYIVSDNDAV 234
            :.|.|.|...:...| .::.|||.:.|:|.   ..|.|.|.::....:....||...|...|:  
  Fly   192 KILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNE-- 254

  Fly   235 IQVPGLLRESAYEIMFEAS---NERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLA 296
                   |....|.:|:.|   .|...:......||:.|.:|:|:.|..:..|.||.:|..|:..
  Fly   255 -------RFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIAD 312

  Fly   297 RLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKS 361
            |:::|:..|..          ..::.|.. |..::.::.|:||::..:....|...:.|:.|.:|
  Fly   313 RMQKEITALAP----------STMKIKII-APPERKYSVWIGGSILASLSTFQQMWISKQEYDES 366

  Fly   362  361
              Fly   367  366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 77/365 (21%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 82/387 (21%)
Act5CNP_001014725.1 PTZ00281 1..376 CDD:173506 83/390 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467769
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.