DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actl9

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001101547.1 Gene:Actl9 / 314659 RGDID:1306886 Length:415 Species:Rattus norvegicus


Alignment Length:411 Identity:91/411 - (22%)
Similarity:163/411 - (39%) Gaps:104/411 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SVMQEKPP-----IVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIRKR-------------- 51
            ||:.::.|     :|:|:||...|:|||.::     .||..|.|..|.:.:              
  Rat    38 SVVGDRFPLKTGAVVIDMGTGTCKVGFAGQS-----QPTYSVATILGCQPKKQATKGQSELETFI 97

  Fly    52 --------------------LFDYDTPEELYDQLVDFLQTIFFKHLL-----VSPKERKFVLVEN 91
                                :.|::..|            :.::|:|     |:.:|...:..:.
  Rat    98 GEAARSRPELRLVKPIRNGIVVDWEAAE------------LIWRHILEHDLRVATQEHPLLFSDP 150

  Fly    92 VFGSTVLRETLARVLF--VHFDVSSVLFVPVHLIALSTLAV-----PTALVVDVGYSETSVMPVF 149
            .|.....||.|..|.|  :|   |..|:|    .:.|.|:|     ...||||.|:..:..:||.
  Rat   151 PFSPATNREKLVEVAFESLH---SPALYV----ASQSVLSVYAHGRVNGLVVDTGHGVSYTVPVV 208

  Fly   150 SGVQIMAAFKDQSYGGSAIHAEIKRQLVESGVKESLLTE--SVLEDIKVRTCFVTT-MERAKARA 211
            .|..:..|.:.....|:.:.|.:...::.||.  ||..|  .::|:||...|::.: .::.:||.
  Rat   209 QGYNLPHAIQRLDLAGNHLTAFLAEMILGSGF--SLQQEDLDLVENIKHHYCYLASDFQKEQARP 271

  Fly   212 NGDENQPTPAPDVDYIVSDNDAVIQVPGLLRESAYEIMFEASN----ERDSLPHLILRSILDCTL 272
            :.:..|....|| ...|:....:.|.|        |::|....    ....||.:..:|:|....
  Rat   272 DQECKQTLRLPD-GRTVTLGKELFQCP--------ELLFHPPEIPGLSPMGLPAMAEQSLLRVPQ 327

  Fly   273 DVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWL 337
            |:|..:.::|.|.||.|:..||.:|.|.||...|:.:....           ..|...:|.:.|:
  Rat   328 DLRPHVAQNVILCGGSSLFTGLESRFRAELLRSLSPEDHVV-----------VMAQPNRNLSVWI 381

  Fly   338 GGALCGATDLIQTRSLVKETY 358
            ||::..:....|:..:::|.|
  Rat   382 GGSILASLHAFQSCWVLREQY 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 85/386 (22%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 89/405 (22%)
Actl9NP_001101547.1 NBD_sugar-kinase_HSP70_actin 46..415 CDD:302596 88/403 (22%)
Actin 48..414 CDD:278451 88/401 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.