DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actl7a

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001011973.1 Gene:Actl7a / 298017 RGDID:1304697 Length:440 Species:Rattus norvegicus


Alignment Length:416 Identity:90/416 - (21%)
Similarity:169/416 - (40%) Gaps:94/416 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PIYESVMQEKP------PIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTG------------- 47
            |:..:|.:::|      .:|:|:||.:.|.|||  ..|:   ||..:.||.|             
  Rat    59 PVKSAVSKDRPRLEVTKAVVVDLGTGFCKCGFA--GLPK---PTHKISTTVGKPYMETAKTGDNR 118

  Fly    48 ----IRKRLFDYDTPEEL-----------YDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTV 97
                :.:.||:.|...:|           :|.:.|..:.:|.:.:.::|:|...::.:.......
  Rat   119 KETFVGRELFNPDIHLKLVNPLRHGIIVDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHT 183

  Fly    98 LRETLARVLFVHFDVSSVLFVPVHLIALSTLAV-----PTALVVDVGYSETSVMPVFSGVQIMAA 157
            .||..|.:||..|:..:     :|:...|.|::     .:.|||:||:..:.|:|::.|..:.:.
  Rat   184 NREKYAEMLFETFNTPA-----MHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYEGYPLPSI 243

  Fly   158 FKDQSYGGSAIHAEIKRQLVESGVKESLLTESVLEDIKVRTCFVT--TMERAKARANGDENQPTP 220
            .....|.||.:...:...:...|...|....|::||||.:.|||.  .:|..|.        |..
  Rat   244 TGRLDYAGSDLTNYLMNLMNNCGKHFSEDHLSIVEDIKTKCCFVALDPIEEKKI--------PPS 300

  Fly   221 APDVDYIVSDNDAVIQVPGLLRESAYEIMFEASNERDSLPHLI-----------LRSILDCTLDV 274
            ..::.|.:.|...:..  |..|....|:.|:        |.||           :..:..|.:.:
  Rat   301 EHEIHYTLPDGKEIRL--GQERFLCSEMFFK--------PSLIKSMQLGLHTQTVSCLNKCDIAL 355

  Fly   275 RRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGG 339
            :|.|:.::.|.||.:|::|...||::||..:...|.            ...|.:.:::...|.||
  Rat   356 KRDLMGNILLCGGSTMLRGFPNRLQKELSSMCPNDT------------PQVNVLPERDTAVWTGG 408

  Fly   340 ALCGATDLIQTRSLVKETYLKSEHVP 365
            ::..:....|...:.:..|  .||.|
  Rat   409 SILASLQGFQPLWVHRLEY--EEHGP 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 82/380 (22%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 88/406 (22%)
Actl7aNP_001011973.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
ACTL7A_N 6..70 CDD:293445 2/10 (20%)
Required for interaction with TES. /evidence=ECO:0000250 36..56
NBD_sugar-kinase_HSP70_actin 72..440 CDD:302596 87/403 (22%)
ACTIN 74..440 CDD:214592 87/401 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D964605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.