DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and SPBC56F2.03

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_596714.1 Gene:SPBC56F2.03 / 2540863 PomBaseID:SPBC56F2.03 Length:380 Species:Schizosaccharomyces pombe


Alignment Length:353 Identity:70/353 - (19%)
Similarity:131/353 - (37%) Gaps:111/353 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KFVLVENVFGSTVLRETLARVLFVHFDVSSVLFVPVHLIALSTLAVPTALVVDVG---------- 139
            :.|||.::|.:...::.|...||...:|...|::...|.|:.:.:...|::||:|          
pombe    68 RVVLVLDIFVTRKQKKELCDGLFNTLNVPITLWICAPLTAILSTSTRDAIIVDIGMKETKFIVIL 132

  Fly   140 -------YSETSVMPVFSGVQIMA-AFK------------DQSYGGSAIHAEIKRQLVESGV--- 181
                   |::||...:.:.::.|| .||            |:.:   |:...:.:.|::|.|   
pombe   133 DLCILMHYTKTSKRSLSTVLERMADCFKLNNKKNSQKLLEDEEF---AVTEALMKSLLKSRVPSK 194

  Fly   182 ----------KESLLTESVLEDIKVRTCFVTTMERAKARANGDENQPTPAPDVDYIVSDNDA-VI 235
                      :|:....|.:..:...||.....||..                    |.||| .|
pombe   195 PTEELYQLTDQEAYFRYSDILPLAETTCQTNKTERGS--------------------SFNDAEKI 239

  Fly   236 QVPGLLRESAYEIMFEASNERDS------LPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGL 294
            :||..:..:..|.:||.|:...|      ||:::|.......:|:||.:.:.:       :..|:
pombe   240 RVPSWIANAGIEALFEGSDAGGSDIADQALPNVLLSLYRILPIDIRRIMSKLI-------VFNGI 297

  Fly   295 LARLRQELQHLLTEDPFYAERFHGELQFK--FFNAVGKQ---NFTAWLGGALCGATDL------- 347
            |..|           |.:.:||..|:..:  ...||..|   :..||.|.:....:.|       
pombe   298 LPSL-----------PGWYQRFQNEMTSRGLAIKAVPGQTTADMMAWNGASTTCESQLDYDPDDP 351

  Fly   348 -------IQTRSLV-KETYLKSEHVPDW 367
                   :::..|. ::.|...|:.|:|
pombe   352 KHLRHSIVESPLLYGQDQYFNGENAPEW 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 64/309 (21%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 69/351 (20%)
SPBC56F2.03NP_596714.1 NBD_sugar-kinase_HSP70_actin <69..338 CDD:302596 64/309 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005826
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.