DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actl7b

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_079547.2 Gene:Actl7b / 11471 MGIID:1343053 Length:418 Species:Mus musculus


Alignment Length:379 Identity:83/379 - (21%)
Similarity:149/379 - (39%) Gaps:60/379 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIRKRLFDYDTPEEL----------------- 61
            :|:|:|:.|.|.|:|.|  ||   ||..:.:|.|.|......|..:..                 
Mouse    54 LVIDLGSQYCKCGYAGE--PR---PTYFISSTVGKRSAEMAADAGDNFKETYVGHELLNMEASLK 113

  Fly    62 ------------YDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVSS 114
                        :|.:.:..:.||...:.:.|:|...::.:.....|..||..|.:||..|.:.:
Mouse   114 LVNPLKHGVVVDWDCIQNIWEYIFHTAMKIMPEEHAVLVSDPPLSPTSNREKYAELLFETFGIPA 178

  Fly   115 VLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQLVES 179
            :......|:::.:....:.|||:.|:..:.|:|:..|..:........|.|..:...:.:.|.|:
Mouse   179 MHVTSQALLSIYSYGKTSGLVVESGHGVSHVVPISEGDLLPGLPSRVDYAGCDLTNYLMQLLNEA 243

  Fly   180 GVKESLLTESVLEDIKVRTCFVTTMERAKARANGDENQPTPAPDVDYIVSDNDAVIQVPGLLRES 244
            |.|.|.....::|.||.:.|:...:...:.....||..      |||.:.|. .:|.: |..|..
Mouse   244 GHKFSDDHLHIIEHIKKKCCYAALLPEEEMSLGLDELH------VDYELPDG-KIITI-GQERFR 300

  Fly   245 AYEIMFEAS---NERDSLPHLILRSILDCT-LDVRRALVESVFLVGGGSMVQGLLARLRQELQHL 305
            ..|::|:.|   ..:..||.|....:..|. ...:..:..:|.|.||.:|:.|...|.::||..|
Mouse   301 CSEMLFKPSLVGCTQPGLPELTATCLARCQGTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLL 365

  Fly   306 LTED-PFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETY 358
            ...| |..|             |..::..:.|.||::..:....|...:.||.:
Mouse   366 CPGDSPTVA-------------AAPERKTSVWTGGSILASLQAFQQLWVSKEEF 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 79/359 (22%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 83/379 (22%)
Actl7bNP_079547.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
ACTIN 52..418 CDD:214592 83/379 (22%)
NBD_sugar-kinase_HSP70_actin 53..418 CDD:302596 83/379 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D964605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.