DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and ACTL7A

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_006678.1 Gene:ACTL7A / 10881 HGNCID:161 Length:435 Species:Homo sapiens


Alignment Length:425 Identity:93/425 - (21%)
Similarity:167/425 - (39%) Gaps:112/425 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PIYESVMQEKP------PIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTG-----------IR 49
            |......:|:|      .:|:|:||.|.|.|||  ..||   ||..:.||.|           .|
Human    54 PTESKAAKERPKQEVTKAVVVDLGTGYCKCGFA--GLPR---PTHKISTTVGKPYMETAKTGDNR 113

  Fly    50 KRLF------------------------DYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVE 90
            |..|                        |:||.:::::.|       |.:.:.::|:|...::.:
Human   114 KETFVGQELNNTNVHLKLVNPLRHGIIVDWDTVQDIWEYL-------FRQEMKIAPEEHAVLVSD 171

  Fly    91 NVFGSTVLRETLARVLFVHFDVSSVLFVPVHLIALSTLAV-----PTALVVDVGYSETSVMPVFS 150
            ........||..|.:||..|:..:     :|:...|.|::     .:.|||:||:..:.|:|::.
Human   172 PPLSPHTNREKYAEMLFEAFNTPA-----MHIAYQSRLSMYSYGRTSGLVVEVGHGVSYVVPIYE 231

  Fly   151 GVQIMAAFKDQSYGGSAIHAEIKRQLVESGVKESLLTESVLEDIKVRTCFVT--TMERAKARANG 213
            |..:.:......|.||.:.|.:...|..:|.:.:.....::||||.:.|||.  .:|..|.    
Human   232 GYPLPSITGRLDYAGSDLTAYLLGLLNSAGNEFTQDQMGIVEDIKKKCCFVALDPIEEKKV---- 292

  Fly   214 DENQPTPAPDVDYIVSDNDAVIQVPGLLRES--AYEIMFEASNERDSLPHLI-----------LR 265
                |.....:.|::.|...:    .|.:|.  ..|:.|:        |.||           :.
Human   293 ----PLSEHTIRYVLPDGKEI----QLCQERFLCSEMFFK--------PSLIKSMQLGLHTQTVS 341

  Fly   266 SILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKFFNAVGK 330
            .:..|.:.::|.|:.::.|.||.:|:.|...||::||..:...|.            ...|.:.:
Human   342 CLNKCDIALKRDLMGNILLCGGSTMLSGFPNRLQKELSSMCPNDT------------PQVNVLPE 394

  Fly   331 QNFTAWLGGALCGATDLIQTRSLVKETYLKSEHVP 365
            ::...|.||::..:....|...:.:..|  .||.|
Human   395 RDSAVWTGGSILASLQGFQPLWVHRFEY--EEHGP 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 85/389 (22%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 91/415 (22%)
ACTL7ANP_006678.1 ACTL7A_N 1..65 CDD:293445 2/10 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64 2/9 (22%)
Required for interaction with TES 31..51
NBD_sugar-kinase_HSP70_actin 67..435 CDD:302596 90/412 (22%)
ACTIN 69..435 CDD:214592 90/410 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D964605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.