DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and ACTL7B

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_006677.1 Gene:ACTL7B / 10880 HGNCID:162 Length:415 Species:Homo sapiens


Alignment Length:381 Identity:80/381 - (20%)
Similarity:153/381 - (40%) Gaps:65/381 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIR-----------------KRLFDYDTPEEL 61
            :::|:|:.|.|.|:|.|  ||   ||..:.:|.|.|                 ..|.:.:.|.:|
Human    52 VIIDLGSQYCKCGYAGE--PR---PTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKL 111

  Fly    62 -----------YDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVSSV 115
                       :|.:.|..:.||...:.:.|:|...::.:.....:..||..|.::|..|.:.::
Human   112 VNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAM 176

  Fly   116 LFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKRQLVESG 180
            ......|:::.:....:.|||:.|:..:.|:|:..|..:........|.|..:...:.:.|.|:|
Human   177 HVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAG 241

  Fly   181 VKESLLTES---VLEDIKVRTCFVTTMERAKARANGDENQPTPAPDVDYIVSDNDAVIQVPGLLR 242
               ...|:.   ::|.||.:.|:...:...:.....:|.:      |||.:.|...:  ..|..|
Human   242 ---HAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELR------VDYELPDGKLI--TIGQER 295

  Fly   243 ESAYEIMFE---ASNERDSLPHLILRSILDC-TLDVRRALVESVFLVGGGSMVQGLLARLRQELQ 303
            ....|::|:   |.:.:..||.|....:..| ....:..:..:|.|.||.:|:.|...|.::||.
Human   296 FRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELS 360

  Fly   304 HLLTED-PFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQTRSLVKETY 358
            .|...| |..|             |..::..:.|.||::..:....|...:.||.:
Human   361 LLCPGDSPAVA-------------AAPERKTSVWTGGSILASLQAFQQLWVSKEEF 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 76/361 (21%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 80/381 (21%)
ACTL7BNP_006677.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
NBD_sugar-kinase_HSP70_actin 51..415 CDD:327376 80/381 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D964605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.