DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Acte1

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001356763.1 Gene:Acte1 / 102636989 MGIID:2685344 Length:382 Species:Mus musculus


Alignment Length:406 Identity:78/406 - (19%)
Similarity:160/406 - (39%) Gaps:91/406 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEV-VMTTTGI------------------------- 48
            ||.|:|.|.|:.::|:||:....|:.:.||.: .|..||:                         
Mouse     2 EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTGLSGPACVFQNVLEGLGEQDWFIGAET 66

  Fly    49 --------------RKRLFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLR 99
                          |..:.::|..|:::       ...|:..|.::|::...::.|....|...:
Mouse    67 QTNRTELNMYYPISRGAITNWDNVEKIW-------HYSFYHSLQIAPEQHPILITEAPLTSKEAK 124

  Fly   100 ETLARVLFVHFDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYG 164
            ..:.::||..|:..::......:::|......:...::.|...|..:||.:|..:..:.......
Mouse   125 SRMTQILFETFNFPALYTANQAVLSLIASGRTSGTAIESGDGMTYFVPVMNGYPLHLSTTKLDIA 189

  Fly   165 GSAIHAEIKRQLVESG-VKESLLTESVLEDIKVRTCFVT---TMERAKARANGDENQPTPAPDVD 225
            |..:...:.:.|.::| |.|::.....:.|:|.:..:|.   .||.:|..|...:.:.| .||..
Mouse   190 GQDLTLYLMKLLSDNGNVLETIADLEYIRDLKDKYSYVALDYNMEMSKTSAPSFQKKFT-LPDGK 253

  Fly   226 YIVSDNDAVIQVPGLLRESAYEIMFEASNERDSLP--HLI-LRSILDCTLDVRRALVESVFLVGG 287
            .|....:|.:         ..|::|:.|....:.|  |:: |.||:.|....:|.|...:.|.||
Mouse   254 EINLGQEAFM---------CSEVLFDTSLLERANPGIHMLTLESIMSCEKSHQRTLFNYIVLTGG 309

  Fly   288 GSMVQGLLARLRQELQHLLTED--------PFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGA 344
            .|...||..|:::|:..:::.|        | ||:                  ::||:|.::..:
Mouse   310 TSACTGLRFRMQKEMAKVVSPDFCVKVTASP-YAK------------------YSAWIGASILSS 355

  Fly   345 TDLIQTRSLVKETYLK 360
            ..|.:...:....||:
Mouse   356 LPLFKDMWITNHEYLE 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 74/383 (19%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 76/404 (19%)
Acte1NP_001356763.1 NBD_sugar-kinase_HSP70_actin 2..382 CDD:354300 78/406 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.