DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Arp10 and Actl10

DIOPT Version :9

Sequence 1:NP_001285452.1 Gene:Arp10 / 32969 FlyBaseID:FBgn0031050 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_003749645.1 Gene:Actl10 / 100911682 RGDID:6491130 Length:334 Species:Rattus norvegicus


Alignment Length:364 Identity:78/364 - (21%)
Similarity:133/364 - (36%) Gaps:80/364 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GFAAEAYPRKIMPTEVVMTTTGIRKRLFDYDTPEELYDQL-VDFLQTIFFKHLLVSPKERKFVLV 89
            |..|.|:|.|          .|:   :.|:|..|.|:::| |..||        :.|::...::.
  Rat    19 GGVARAHPIK----------HGV---VVDWDALEGLWERLMVGGLQ--------IHPEQWPVLVS 62

  Fly    90 ENVFGSTVLRETLARVLFVHFDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFSGVQI 154
            ::.......||.:|.:||....|.:.......|:||.::...:.|.|:.|.......|:::|...
  Rat    63 DSPSAPPEGREKVAELLFEALTVPACHMASTALLALCSVGAFSGLAVEAGAGVCHATPIYAGHSW 127

  Fly   155 MAAFKDQSYGGSAIHAEIKRQLVES--GVKESLLTESVLEDIKVRTCFVT------TMERAKARA 211
            ..|....:..||.:....:..||.|  .::...|....:..:|.|.|:|:      ..:.|:.:.
  Rat   128 HKATFRLNVAGSTLSRYFRDLLVASCPDLQLHALPRKTVTQLKKRCCYVSLDFQGDICDPARHQR 192

  Fly   212 N------------GDENQPTPAPDVDYIVSDNDAVIQVPGLLRESAYEIMFEASNERDSLPHLIL 264
            .            |.|....|.|            |..|.||           .:....||.|..
  Rat   193 ACFCLGKGCYVRLGSERFRCPEP------------IFQPSLL-----------GHPEPGLPTLAF 234

  Fly   265 RSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAE-RFHG--ELQFKFFN 326
            :::......:|..|..:|.|.||.::..|.:.|:..|||         |: |.||  .||.....
  Rat   235 QALQKIPTTLRTRLANTVVLAGGSTLFPGFVERMNLELQ---------AQCRRHGYPALQPCLVA 290

  Fly   327 AVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKSEHVP 365
            ..|: ....|.||::..:....|.|.:.:..|  .|:.|
  Rat   291 HPGR-GTAVWTGGSMMASLHSFQRRWMTRAMY--QEYGP 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Arp10NP_001285452.1 ACTIN 11..340 CDD:214592 72/337 (21%)
NBD_sugar-kinase_HSP70_actin 12..367 CDD:302596 78/364 (21%)
Actl10XP_003749645.1 NBD_sugar-kinase_HSP70_actin 25..329 CDD:302596 75/358 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.