DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61gamma and SSS1

DIOPT Version :10

Sequence 1:NP_608337.1 Gene:Sec61gamma / 32968 FlyBaseID:FBgn0031049 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_010371.1 Gene:SSS1 / 851659 SGDID:S000002493 Length:80 Species:Saccharomyces cerevisiae


Alignment Length:65 Identity:27/65 - (41%)
Similarity:40/65 - (61%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFIGFFVKLIHIPINNIIV 66
            ::|.|..|....|.::..:.:.:|.|||.||:.||..|..:||..:|.||:.:|||||||..:||
Yeast    16 NQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIHIPIRYVIV 80

  Fly    67  66
            Yeast    81  80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61gammaNP_608337.1 secE <12..68 CDD:469787 24/55 (44%)
SSS1NP_010371.1 secE_euk_arch 20..80 CDD:273016 24/59 (41%)

Return to query results.
Submit another query.