DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61gamma and SSS1

DIOPT Version :9

Sequence 1:NP_001285450.1 Gene:Sec61gamma / 32968 FlyBaseID:FBgn0031049 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_010371.1 Gene:SSS1 / 851659 SGDID:S000002493 Length:80 Species:Saccharomyces cerevisiae


Alignment Length:65 Identity:27/65 - (41%)
Similarity:40/65 - (61%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFIGFFVKLIHIPINNIIV 66
            ::|.|..|....|.::..:.:.:|.|||.||:.||..|..:||..:|.||:.:|||||||..:||
Yeast    16 NQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIHIPIRYVIV 80

  Fly    67  66
            Yeast    81  80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61gammaNP_001285450.1 SecE <12..68 CDD:412402 24/55 (44%)
SSS1NP_010371.1 Sss1 15..79 CDD:225292 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344707
Domainoid 1 1.000 56 1.000 Domainoid score I2690
eggNOG 1 0.900 - - E1_COG2443
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I1779
Isobase 1 0.950 - 0 Normalized mean entropy S323
OMA 1 1.010 - - QHG53965
OrthoFinder 1 1.000 - - FOG0001695
OrthoInspector 1 1.000 - - otm46826
orthoMCL 1 0.900 - - OOG6_101625
Panther 1 1.100 - - LDO PTHR12309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1245
TreeFam 1 0.960 - -
1413.710

Return to query results.
Submit another query.