DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61gamma and AT3G48570

DIOPT Version :9

Sequence 1:NP_001285450.1 Gene:Sec61gamma / 32968 FlyBaseID:FBgn0031049 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_566909.1 Gene:AT3G48570 / 824017 AraportID:AT3G48570 Length:69 Species:Arabidopsis thaliana


Alignment Length:68 Identity:44/68 - (64%)
Similarity:55/68 - (80%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFIGFFVKLIHIPINNII 65
            |:.:....:|.|.|||.|:|||:||.|||||||.|:|:.||:||.:|||:||||||:.|||||||
plant     1 MEAIDSAIDPLRDFAKSSVRLVQRCHKPDRKEFTKVAVRTAIGFVVMGFVGFFVKLVFIPINNII 65

  Fly    66 VGS 68
            |||
plant    66 VGS 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61gammaNP_001285450.1 SecE <12..68 CDD:412402 40/55 (73%)
AT3G48570NP_566909.1 SecE <11..68 CDD:412402 40/56 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 92 1.000 Domainoid score I2580
eggNOG 1 0.900 - - E1_COG2443
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I2148
OMA 1 1.010 - - QHG53965
OrthoDB 1 1.010 - - D1623399at2759
OrthoFinder 1 1.000 - - FOG0001695
OrthoInspector 1 1.000 - - mtm1011
orthoMCL 1 0.900 - - OOG6_101625
Panther 1 1.100 - - O PTHR12309
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.