DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61gamma and Sec61g

DIOPT Version :9

Sequence 1:NP_001285450.1 Gene:Sec61gamma / 32968 FlyBaseID:FBgn0031049 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_001128492.1 Gene:Sec61g / 689134 RGDID:1596170 Length:68 Species:Rattus norvegicus


Alignment Length:67 Identity:57/67 - (85%)
Similarity:62/67 - (92%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFIGFFVKLIHIPINNII 65
            ||:|::|.||.|.|.||||||||||||||||||||||:|||:||.||||||||||||||||||||
  Rat     1 MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNII 65

  Fly    66 VG 67
            ||
  Rat    66 VG 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61gammaNP_001285450.1 SecE <12..68 CDD:412402 51/56 (91%)
Sec61gNP_001128492.1 SecE <12..68 CDD:412402 51/56 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345421
Domainoid 1 1.000 103 1.000 Domainoid score I6630
eggNOG 1 0.900 - - E1_COG2443
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I4655
OMA 1 1.010 - - QHG53965
OrthoDB 1 1.010 - - D1623399at2759
OrthoFinder 1 1.000 - - FOG0001695
OrthoInspector 1 1.000 - - mtm9113
orthoMCL 1 0.900 - - OOG6_101625
Panther 1 1.100 - - LDO PTHR12309
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1245
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.