powered by:
Protein Alignment Sec61gamma and CG8860
DIOPT Version :9
Sequence 1: | NP_001285450.1 |
Gene: | Sec61gamma / 32968 |
FlyBaseID: | FBgn0031049 |
Length: | 68 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610738.1 |
Gene: | CG8860 / 36310 |
FlyBaseID: | FBgn0033691 |
Length: | 68 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 67/68 - (98%) |
Similarity: | 67/68 - (98%) |
Gaps: | 0/68 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFIGFFVKLIHIPINNII 65
||||||||||||||||||||||||||||||||||||||||||||.||||||||||||||||||||
Fly 1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNII 65
Fly 66 VGS 68
|||
Fly 66 VGS 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Sec61gamma | NP_001285450.1 |
SecE |
<12..68 |
CDD:412402 |
54/55 (98%) |
CG8860 | NP_610738.1 |
SecE |
<12..68 |
CDD:412402 |
54/55 (98%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45456401 |
Domainoid |
1 |
1.000 |
92 |
1.000 |
Domainoid score |
I2580 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2443 |
Homologene |
1 |
1.000 |
- |
- |
|
H40767 |
Inparanoid |
1 |
1.050 |
103 |
1.000 |
Inparanoid score |
I2148 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1623399at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001695 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm26167 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101625 |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12309 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1245 |
|
12 | 11.800 |
|
Return to query results.
Submit another query.