DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61gamma and CG8860

DIOPT Version :9

Sequence 1:NP_001285450.1 Gene:Sec61gamma / 32968 FlyBaseID:FBgn0031049 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_610738.1 Gene:CG8860 / 36310 FlyBaseID:FBgn0033691 Length:68 Species:Drosophila melanogaster


Alignment Length:68 Identity:67/68 - (98%)
Similarity:67/68 - (98%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFIGFFVKLIHIPINNII 65
            ||||||||||||||||||||||||||||||||||||||||||||.||||||||||||||||||||
  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNII 65

  Fly    66 VGS 68
            |||
  Fly    66 VGS 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61gammaNP_001285450.1 SecE <12..68 CDD:412402 54/55 (98%)
CG8860NP_610738.1 SecE <12..68 CDD:412402 54/55 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456401
Domainoid 1 1.000 92 1.000 Domainoid score I2580
eggNOG 1 0.900 - - E1_COG2443
Homologene 1 1.000 - - H40767
Inparanoid 1 1.050 103 1.000 Inparanoid score I2148
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623399at2759
OrthoFinder 1 1.000 - - FOG0001695
OrthoInspector 1 1.000 - - otm26167
orthoMCL 1 0.900 - - OOG6_101625
Panther 1 1.100 - - P PTHR12309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1245
1211.800

Return to query results.
Submit another query.