DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61gamma and sss1

DIOPT Version :9

Sequence 1:NP_001285450.1 Gene:Sec61gamma / 32968 FlyBaseID:FBgn0031049 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_593061.1 Gene:sss1 / 2543140 PomBaseID:SPAC4G8.02c Length:70 Species:Schizosaccharomyces pombe


Alignment Length:54 Identity:31/54 - (57%)
Similarity:39/54 - (72%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFIGFFVKLIHIPINNIIVG 67
            |.|:....:|||.|||||||..|:.|.|.||.:||.||:.:||||||||.::||
pombe    15 FYKEGSHFIKRCVKPDRKEFLSISKAVATGFVLMGLIGYIIKLIHIPINKVLVG 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61gammaNP_001285450.1 SecE <12..68 CDD:412402 31/54 (57%)
sss1NP_593061.1 Sss1 3..66 CDD:225292 29/50 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 70 1.000 Domainoid score I2655
eggNOG 1 0.900 - - E1_COG2443
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I1911
OMA 1 1.010 - - QHG53965
OrthoFinder 1 1.000 - - FOG0001695
OrthoInspector 1 1.000 - - otm47281
orthoMCL 1 0.900 - - OOG6_101625
Panther 1 1.100 - - LDO PTHR12309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1245
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.