DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec61gamma and sec-61.G

DIOPT Version :9

Sequence 1:NP_001285450.1 Gene:Sec61gamma / 32968 FlyBaseID:FBgn0031049 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_001379136.1 Gene:sec-61.G / 179510 WormBaseID:WBGene00001303 Length:68 Species:Caenorhabditis elegans


Alignment Length:68 Identity:53/68 - (77%)
Similarity:59/68 - (86%) Gaps:0/68 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFIGFFVKLIHIPINNII 65
            ||:.....||.|.|:|||.|||||||||||||:||||:|||:||.||||||||||||||||||||
 Worm     1 MDQFQALIEPARQFSKDSYRLVKRCTKPDRKEYQKIAMATAIGFAIMGFIGFFVKLIHIPINNII 65

  Fly    66 VGS 68
            ||:
 Worm    66 VGA 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec61gammaNP_001285450.1 SecE <12..68 CDD:412402 48/55 (87%)
sec-61.GNP_001379136.1 SecE <11..68 CDD:412402 48/56 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162228
Domainoid 1 1.000 100 1.000 Domainoid score I4408
eggNOG 1 0.900 - - E1_COG2443
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40767
Inparanoid 1 1.050 113 1.000 Inparanoid score I3422
Isobase 1 0.950 - 0 Normalized mean entropy S323
OMA 1 1.010 - - QHG53965
OrthoDB 1 1.010 - - D1623399at2759
OrthoFinder 1 1.000 - - FOG0001695
OrthoInspector 1 1.000 - - otm14547
orthoMCL 1 0.900 - - OOG6_101625
Panther 1 1.100 - - LDO PTHR12309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1245
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.720

Return to query results.
Submit another query.