DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12237 and Phospho2

DIOPT Version :9

Sequence 1:NP_608336.1 Gene:CG12237 / 32967 FlyBaseID:FBgn0031048 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_082797.1 Gene:Phospho2 / 73373 MGIID:1920623 Length:241 Species:Mus musculus


Alignment Length:234 Identity:83/234 - (35%)
Similarity:133/234 - (56%) Gaps:4/234 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LAAFDFDHTIVSQNTDTVVRDLLPTEVTSAKVNELVENDCWTEYMAEVFRLLHEQQVSEARIRDT 93
            |..||||:||:..|:||.:....|.:....::.:..:...|||:|..||:.|.::.|....::..
Mouse     4 LLVFDFDNTIIDDNSDTWIVQCAPDKKLPIELQDSYQKGLWTEFMGRVFKYLRDEGVKADELKRA 68

  Fly    94 IRGIPEVPGFVRLIKHL-AKRLHYDLIIISDSNSVFIDEWLRAHNLADCFVAIFTNPAEFDASGR 157
            :..:|...|.:.|:..| ..:..:|.||||||||:|||..|.|....|.|..:|||||.||:|||
Mouse    69 VTSLPFTSGMIELLSFLRMNKDRFDCIIISDSNSIFIDWVLEAAAFHDVFDHVFTNPASFDSSGR 133

  Fly   158 LMVRAHHQQSDCKLSASNLCKGRVLEHFVIEQDLRRSIRYDHVFYVGDGNNDICPVLRQRACDFA 222
            |.|:.:|..| |.....||||..||..| |::.|::.:||..:.|:|||.||:|||...:..|.|
Mouse   134 LTVKNYHAHS-CTRCPKNLCKNTVLGEF-IDKQLQKGVRYTRIVYIGDGGNDVCPVTFLKKNDVA 196

  Fly   223 CARKGFAMEKHLLRNRSKLK-LRAQLLIWKSGFDLMDQM 260
            ..|:|:.:.:.|.:....|: :.:.:::|.||.:::..:
Mouse   197 MPREGYTLHRTLAKMSQNLEPMESSIVVWSSGVEIISHL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12237NP_608336.1 Put_Phosphatase 30..264 CDD:284339 82/233 (35%)
Phospho2NP_082797.1 Put_Phosphatase 3..239 CDD:284339 83/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834896
Domainoid 1 1.000 164 1.000 Domainoid score I3927
eggNOG 1 0.900 - - E1_KOG3120
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41756
Inparanoid 1 1.050 164 1.000 Inparanoid score I4192
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57813
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002454
OrthoInspector 1 1.000 - - otm43499
orthoMCL 1 0.900 - - OOG6_103740
Panther 1 1.100 - - LDO PTHR20889
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5703
SonicParanoid 1 1.000 - - X1634
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.