DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12237 and phospho2

DIOPT Version :9

Sequence 1:NP_608336.1 Gene:CG12237 / 32967 FlyBaseID:FBgn0031048 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001007942.1 Gene:phospho2 / 493318 XenbaseID:XB-GENE-1002120 Length:238 Species:Xenopus tropicalis


Alignment Length:242 Identity:88/242 - (36%)
Similarity:135/242 - (55%) Gaps:13/242 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RRLAAFDFDHTIVSQNTDTVVRDLLPTEVTSAKVNELVENDCWTEYMAEVFRLLHEQQVSEARIR 91
            :.|..|||||||::.|:||.:...:|.:.....:....|...|||||..||..|.||.:.|..::
 Frog     2 KTLLVFDFDHTIINDNSDTWIVQCVPGKKLPNGLQNSYEKGKWTEYMGRVFSYLGEQGIREEDMK 66

  Fly    92 DTIRGIPEVPGFVRLIKHLAK-RLHYDLIIISDSNSVFIDEWLRAH-NLADCFVAIFTNPAEFDA 154
            ..:..||..||...|:..:.: :..:|.|||||||::||| |:..| |:.:.|..:|||||.||:
 Frog    67 RIMIAIPYTPGMTDLLHFIGQNKDSFDCIIISDSNTIFID-WILTHANVHNVFDKVFTNPAAFDS 130

  Fly   155 SGRLMVR---AHHQQSDCKLSASNLCKGRVLEHFVIEQDLRRSIRYDHVFYVGDGNNDICPVLRQ 216
            .|.|.|:   .||    |....:||||.:|||.||.:|. ..|..|..:.|||||.||:|||...
 Frog   131 VGNLTVQNFHVHH----CTTCPTNLCKKKVLEEFVAKQS-SNSAHYSKIVYVGDGGNDLCPVTFL 190

  Fly   217 RACDFACARKGFAMEKHLLRNRSKLKLRAQLLIWKSGFDLMDQMLAL 263
            :..|.|..|.|:.::||:.::.:.:.  :.:.:|.:|.:::..:..|
 Frog   191 KKGDIAMPRAGYTLDKHIAKDVTLVD--STISVWSTGAEILSHLKLL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12237NP_608336.1 Put_Phosphatase 30..264 CDD:284339 87/239 (36%)
phospho2NP_001007942.1 HAD_like 3..236 CDD:389748 88/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 157 1.000 Domainoid score I4100
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41756
Inparanoid 1 1.050 158 1.000 Inparanoid score I4165
OMA 1 1.010 - - QHG57813
OrthoDB 1 1.010 - - D1454608at2759
OrthoFinder 1 1.000 - - FOG0002454
OrthoInspector 1 1.000 - - otm48657
Panther 1 1.100 - - LDO PTHR20889
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5703
SonicParanoid 1 1.000 - - X1634
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.