DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12237 and Phospho1

DIOPT Version :9

Sequence 1:NP_608336.1 Gene:CG12237 / 32967 FlyBaseID:FBgn0031048 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_694744.1 Gene:Phospho1 / 237928 MGIID:2447348 Length:267 Species:Mus musculus


Alignment Length:244 Identity:79/244 - (32%)
Similarity:127/244 - (52%) Gaps:10/244 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RRLAAFDFDHTIVSQNTDTVVRDLLPTEVTSAKVNELVENDCWTEYMAEVFRLLHEQQVSEARIR 91
            |.|..||||.|||.:|:|..:....|.:.....:........:.|||..||:.|.||.|....:|
Mouse    26 RFLLTFDFDETIVDENSDDSIVRAAPGQQLPESLRATYREGYYNEYMQRVFKYLGEQGVRPRDLR 90

  Fly    92 DTIRGIPEVPGFVRLIKHLAKR-LHYDLIIISDSNSVFIDEWLRAHNLADCFVAIFTNPAEFDAS 155
            .....||..||...|::.:||: ..:::|:|||:|:..::..|||......|..|.:||:..||.
Mouse    91 AVYETIPLSPGMGDLLQFIAKQGSCFEVILISDANTFGVESALRAAGHHSLFRRILSNPSGPDAR 155

  Fly   156 GRLMVRAHHQQSDCKLSASNLCKGRVLEHFVIEQDLRRSIRYDHVFYVGDGNNDICPVLRQRACD 220
            |.|.:|..|..| |....:|:||.:||..::.|: .|..:.::.:||||||.||.||:......|
Mouse   156 GLLTLRPFHTHS-CSRCPANMCKHKVLSEYLRER-ARDGVHFERLFYVGDGANDFCPMGLLAGGD 218

  Fly   221 FACARKGFAMEKHLLRNRSKLK---LRAQLLIWKSGFDL---MDQMLAL 263
            .|..|:|:.|.: |::...|.:   .||.::.|::..|:   :.|:|.:
Mouse   219 VAFPRRGYPMHR-LIQEAQKAEPSSFRAHVVPWETAADVRQHLQQVLKM 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12237NP_608336.1 Put_Phosphatase 30..264 CDD:284339 77/241 (32%)
Phospho1NP_694744.1 Put_Phosphatase 27..264 CDD:284339 77/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834898
Domainoid 1 1.000 164 1.000 Domainoid score I3927
eggNOG 1 0.900 - - E1_KOG3120
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4192
Isobase 1 0.950 - 0 Normalized mean entropy S7266
OMA 1 1.010 - - QHG57813
OrthoDB 1 1.010 - - D1454608at2759
OrthoFinder 1 1.000 - - FOG0002454
OrthoInspector 1 1.000 - - otm43499
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20889
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1634
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.820

Return to query results.
Submit another query.