DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcd-1 and AT2G32550

DIOPT Version :9

Sequence 1:NP_608335.1 Gene:Rcd-1 / 32966 FlyBaseID:FBgn0031047 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_180814.2 Gene:AT2G32550 / 817816 AraportID:AT2G32550 Length:322 Species:Arabidopsis thaliana


Alignment Length:275 Identity:89/275 - (32%)
Similarity:140/275 - (50%) Gaps:12/275 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 EKVYQWINELAHPDT--RETALLELSKKR-ETDLAP-MLWNSFGTACALLQEIVNIYPSIT---P 84
            |.:.||:.::..|.:  .:.||..|:..| :.:..| :||.|..|...:|||:...|..:.   .
plant    47 EMIIQWVCDIHKPKSYMSDFALHNLAYHRNDFEFLPSLLWESKNTVYIMLQEVFEAYRHLAGHIS 111

  Fly    85 PTLTAHQSN--RVCNALALLQCVASHPETRTAFLQAQIPLYLYPFLSTTSKTRPFEYLRLTSLGV 147
            ..|..|..|  ||.|...|.|.:|.||:|...||:|::|.|.||.:.|....:..|.:||.:|||
plant   112 LRLFPHPLNPLRVYNVFLLFQSMACHPDTSRQFLRAKMPNYFYPLMDTGLIDKSDECMRLAALGV 176

  Fly   148 IGALVKTDEQEVIT-FLLTTEIVPLCLSIMDSGSELSKTVATFIIQKILLDESGLSYICQTYERF 211
            |..::|..|...:. :|:.:.:|..|:..::.||..:|.||.:|:.||:..:.||.|.|...:||
plant   177 IAHMLKASEDGAVNRYLMESGVVGFCVKPIEFGSTETKKVALYILDKIMSTDQGLYYCCVLADRF 241

  Fly   212 SHVAITLGKMVIQLAK--DPCARLLKHVVRCYLRLSDNTRARKALGQCLPDQLRDGTFALCLQED 274
            ..:...|.|::..|:.  .|.:.|...|..||::||.|:|||..:.:..|..|.||||:....||
plant   242 YVIDELLKKVLFYLSNMVRPPSSLFSLVTGCYVKLSQNSRARNGIRRYTPFLLFDGTFSRLYAED 306

  Fly   275 KSTKQWLQMLLKNLE 289
            .........||:||:
plant   307 PVAANNRIQLLQNLD 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcd-1NP_608335.1 Rcd1 40..288 CDD:281998 83/259 (32%)
AT2G32550NP_180814.2 Rcd1 65..320 CDD:281998 83/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5209
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12262
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.