DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcd-1 and CG2053

DIOPT Version :9

Sequence 1:NP_608335.1 Gene:Rcd-1 / 32966 FlyBaseID:FBgn0031047 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001287632.1 Gene:CG2053 / 43762 FlyBaseID:FBgn0039887 Length:298 Species:Drosophila melanogaster


Alignment Length:250 Identity:100/250 - (40%)
Similarity:156/250 - (62%) Gaps:3/250 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QQQTEQEKVYQWINELAHPDTRETALLELSKKRE--TDLAPMLWNSFGTACALLQEIVNIYPSIT 83
            :|:.:.:.|:.||..|.:.:||..|:|||.::|.  ..|..:||:|||....||||||:|||:|.
  Fly     9 EQRGDIDSVFGWIANLCNKETRLWAMLELFERRTHIDSLGLLLWHSFGAVSGLLQEIVSIYPAIY 73

  Fly    84 PP-TLTAHQSNRVCNALALLQCVASHPETRTAFLQAQIPLYLYPFLSTTSKTRPFEYLRLTSLGV 147
            .. .||..||:|:|.|:.|:|.:||||......::.|...||.|.|..||:||..|::||:.|||
  Fly    74 QEIELTGQQSHRICTAIGLIQAMASHPFIGIQLIRCQFMCYLMPLLKMTSQTRAVEHVRLSVLGV 138

  Fly   148 IGALVKTDEQEVITFLLTTEIVPLCLSIMDSGSELSKTVATFIIQKILLDESGLSYICQTYERFS 212
            |..|:|:|..|::::.|.||::||.|..::.|:.:||.:..|::.:.|..|.||.:..:...|..
  Fly   139 ICGLLKSDHPEIVSYFLGTELIPLTLRQLEFGTTMSKVLCAFVLYRTLEHEVGLKFASRRLARKL 203

  Fly   213 HVAITLGKMVIQLAKDPCARLLKHVVRCYLRLSDNTRARKALGQCLPDQLRDGTF 267
            |:..||.::|.||..:|..|:||||||.|.||:|:.:..:.:.:.||.|:|:|.|
  Fly   204 HLIHTLARVVHQLTLEPEPRVLKHVVRIYSRLADHPQNLELILKLLPAQIRNGYF 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcd-1NP_608335.1 Rcd1 40..288 CDD:281998 94/230 (41%)
CG2053NP_001287632.1 Rcd1 28..258 CDD:281998 94/229 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464275
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5209
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1129961at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12262
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.