DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)3 and dpf3

DIOPT Version :9

Sequence 1:NP_001259719.1 Gene:e(y)3 / 32965 FlyBaseID:FBgn0087008 Length:2012 Species:Drosophila melanogaster
Sequence 2:NP_001104639.1 Gene:dpf3 / 562738 ZFINID:ZDB-GENE-041014-190 Length:391 Species:Danio rerio


Alignment Length:319 Identity:83/319 - (26%)
Similarity:121/319 - (37%) Gaps:67/319 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1535 YAYPL----------TVVPDQFSMAYRQFEPAELRAYPLDTALDKPPTDLMAQLLQAKSEAVG-S 1588
            |.||.          |.:..|..:...:.| |||.|     ..:.|.|:  |..|:|.....| .
Zfish    72 YTYPARCWRKKRRLHTPLDPQLRLCELRLE-AELMA-----KREAPQTE--ATALEALLRGDGIL 128

  Fly  1589 DEIKTSAPAPKDLGQEQSAIKS------------VTVTAPVR------RSRRSTRQQTDKV---- 1631
            |:...:|...:.|.:.|..:::            ..|..|.|      |.|.|.|::|:.|    
Zfish   129 DKRNNNAKEEETLLEIQRVLEADENGDGFHDDEDFEVDTPKRKHRNKGRGRGSGRRRTEAVANDD 193

  Fly  1632 ---------RTASSSSTSSAQSVSSASSGN--GSSSD-------TESGDESDFSSTSSCSSSTGA 1678
                     |.....::.:|.||......|  |.|..       .|.|:|...:.... |.....
Zfish   194 QDKPYVCDNRYKQKHNSKTADSVCGKRYKNRPGLSYHYAHTHLAEEEGEEERETEIPQ-SPPVHH 257

  Fly  1679 SSGAGSEDEDGNECSSSVRLSTCGVCLRSQHRNAR-DMPEAFIRCYTCRKRVHPSCVDMPPRMVG 1742
            .:....:..||    |.:....|..||.....|.: ...|..:.|..|.:..||||:.....|:.
Zfish   258 ENHKPQKAPDG----SIIPNDYCDFCLGDSGSNRKTGQAEELVSCSDCGRSGHPSCLQFTDNMMQ 318

  Fly  1743 RVRNYNWQCAGCKCCIKCRSSQRPGKMLYCEQCDRGYHIYCL--GLRTVPDGRWSCERC 1799
            .||.|.|||..||.|..|.:|:...::|:|:.||||||:|||  .:...|:|.|||..|
Zfish   319 AVRTYQWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLKPPMTQPPEGSWSCHLC 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)3NP_001259719.1 PHD_SF 1700..1754 CDD:304600 18/54 (33%)
RanBP2-type Zn finger 1700..1725 CDD:275375 6/25 (24%)
RanBP2-type Zn finger 1749..1775 CDD:275375 10/25 (40%)
PHD2_PHF10 1756..1799 CDD:277004 19/44 (43%)
dpf3NP_001104639.1 Requiem_N 13..84 CDD:290758 3/11 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..200 9/47 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..266 4/30 (13%)
PHD1_DPF2_like 275..330 CDD:277161 18/54 (33%)
PHD2_d4 332..377 CDD:277005 19/44 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10615
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.