DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)3 and CG1894

DIOPT Version :9

Sequence 1:NP_001259719.1 Gene:e(y)3 / 32965 FlyBaseID:FBgn0087008 Length:2012 Species:Drosophila melanogaster
Sequence 2:NP_651620.1 Gene:CG1894 / 43378 FlyBaseID:FBgn0039585 Length:421 Species:Drosophila melanogaster


Alignment Length:269 Identity:50/269 - (18%)
Similarity:89/269 - (33%) Gaps:85/269 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1559 RAYPLDTALDKPPTDLMAQLLQAKSEAVGSDEIKTSAPAPKDLGQEQSAIKSVTVTAPVRRSRRS 1623
            ||..|..|.:...|..:.|  .|....:|..:::..:...|:: ||...|....:.|  :|...:
  Fly    31 RALQLTNAKESSATRGLGQ--SASKSEMGKSQLQNDSSLQKNI-QETKTITGSCIEA--QRIGAT 90

  Fly  1624 TRQQTDKVRTASSSSTSSAQSVSSASSGNGSSSDTESGDESDFSSTSSCSSSTGASSGAGSEDED 1688
            .::|.:.|:  ..:..|...:.:|::..:....:|...::||..                .|.||
  Fly    91 PKKQLEGVK--EPNMISLLHTNASSNVDDRQRQETIDNEKSDVQ----------------KEKED 137

  Fly  1689 GN-----------------ECSSS----------VRLSTCGVCLR--------SQHRNARDMPEA 1718
            ..                 |.:||          ..:..|..||:        |.|         
  Fly   138 AKVKVIRNIEKVQFGRYEIETTSSSPYPVINDKATTIYVCEFCLKYMCLRKSYSYH--------- 193

  Fly  1719 FIRCYTCRKRVHPSCVDMPPRMVGRVRN-YNWQCAG------CKC-CIKCRSSQRPGKMLYCEQC 1775
               .|.|:||..|.      .::.|..| |.::..|      |:| |:..:......|:||....
  Fly   194 ---LYDCKKRCPPG------SLLYRKDNIYIYEVDGHKEQLYCQCLCLMSKLFLENKKILYSSSS 249

  Fly  1776 DRGYHIYCL 1784
            .. ::|.||
  Fly   250 FL-FYILCL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)3NP_001259719.1 PHD_SF 1700..1754 CDD:304600 14/68 (21%)
RanBP2-type Zn finger 1700..1725 CDD:275375 6/32 (19%)
RanBP2-type Zn finger 1749..1775 CDD:275375 7/32 (22%)
PHD2_PHF10 1756..1799 CDD:277004 8/30 (27%)
CG1894NP_651620.1 NAT_SF 130..395 CDD:302625 30/163 (18%)
MOZ_SAS 202..378 CDD:280097 14/63 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.