| Sequence 1: | NP_001259719.1 | Gene: | e(y)3 / 32965 | FlyBaseID: | FBgn0087008 | Length: | 2012 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001259234.1 | Gene: | Tip60 / 31362 | FlyBaseID: | FBgn0026080 | Length: | 541 | Species: | Drosophila melanogaster |
| Alignment Length: | 267 | Identity: | 58/267 - (21%) |
|---|---|---|---|
| Similarity: | 83/267 - (31%) | Gaps: | 90/267 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1046 SSSSTSSGAAANQQ---VIG-----------GSGSSSMLPPT-TILSSSDPLPDVIFQPNDFSSI 1095
Fly 1096 MATQQLRSSRPSSISCGSTGGSQPDCHDEDNYTSALDNSGVNSSSSDETALPMPPTRGRGRGRRS 1160
Fly 1161 RGGRGRGSSSVDRAVSVGGTASTTPATQPRAPRMSRGASAVAKAI----------AMSRPRCVGG 1215
Fly 1216 L-KHQPD-PERLKGL--------------FSPSPQ-----------VFEEDTRMSADLSNSNQSM 1253
Fly 1254 ASLMEPP 1260 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| e(y)3 | NP_001259719.1 | PHD_SF | 1700..1754 | CDD:304600 | |
| RanBP2-type Zn finger | 1700..1725 | CDD:275375 | |||
| RanBP2-type Zn finger | 1749..1775 | CDD:275375 | |||
| PHD2_PHF10 | 1756..1799 | CDD:277004 | |||
| Tip60 | NP_001259234.1 | Tudor-knot | 23..78 | CDD:288553 | |
| Drf_FH1 | 84..>157 | CDD:283903 | 20/86 (23%) | ||
| PHA01732 | 139..>196 | CDD:222828 | 17/94 (18%) | ||
| NAT_SF | 254..533 | CDD:302625 | 14/64 (22%) | ||
| MOZ_SAS | 316..500 | CDD:280097 | 2/2 (100%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45463879 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||