DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)3 and Dpf3

DIOPT Version :9

Sequence 1:NP_001259719.1 Gene:e(y)3 / 32965 FlyBaseID:FBgn0087008 Length:2012 Species:Drosophila melanogaster
Sequence 2:XP_008762968.1 Gene:Dpf3 / 299186 RGDID:1309052 Length:401 Species:Rattus norvegicus


Alignment Length:315 Identity:75/315 - (23%)
Similarity:109/315 - (34%) Gaps:89/315 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1555 PAELRAYPLDTALDK----PPTDLMAQLLQAKSEAVGSDEIKTSAPAPKD-LGQEQSAIKSVTVT 1614
            |.:|..||......|    ||.|...:||:.|.|        ...|..|| ...|.:.::::...
  Rat    91 PGQLYTYPARCWRKKRRLHPPEDPKLRLLEIKPE--------VELPLKKDGFTSESTTLEALLRG 147

  Fly  1615 APVRRSRRSTRQQTDKVRTASSSSTSSAQSVSSASSGNGSSSDTESGDESDFSSTSSCS--SSTG 1677
            ..|.:          ||......|....|.|.. :..|....:.|...|.|.....:.:  .:.|
  Rat   148 EGVEK----------KVDAREEESIQEIQRVLE-NDENVEEGNEEEDLEEDIPKRKNRTRGRARG 201

  Fly  1678 ASSG------AGSED-------------------------------EDGNECSSSVRLST----- 1700
            ::.|      |..||                               |:|:|.......|.     
  Rat   202 SAGGRRRHDAASQEDHDKPYVCDICGKRYKNRPGLSYHYAHTHLASEEGDEAQDQETRSPPNHRN 266

  Fly  1701 ------------------CGVCLRSQHRNARD-MPEAFIRCYTCRKRVHPSCVDMPPRMVGRVRN 1746
                              |..||...:.|.:. .||..:.|..|.:..||:|:.....|...|:.
  Rat   267 ENHRPQKGPDGTVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKT 331

  Fly  1747 YNWQCAGCKCCIKCRSSQRPGKMLYCEQCDRGYHIYCLG--LRTVPDGRWSCERC 1799
            |.|||..||.||.|.:|:...::|:|:.||||||:|||.  :...|:|.|||..|
  Rat   332 YKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLC 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)3NP_001259719.1 PHD_SF 1700..1754 CDD:304600 17/77 (22%)
RanBP2-type Zn finger 1700..1725 CDD:275375 7/48 (15%)
RanBP2-type Zn finger 1749..1775 CDD:275375 11/25 (44%)
PHD2_PHF10 1756..1799 CDD:277004 20/44 (45%)
Dpf3XP_008762968.1 Requiem_N 36..107 CDD:290758 5/15 (33%)
PHD1_DPF3 284..340 CDD:277162 17/55 (31%)
PHD2_d4 341..386 CDD:277005 20/44 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10615
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.