DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)3 and Dpf2

DIOPT Version :9

Sequence 1:NP_001259719.1 Gene:e(y)3 / 32965 FlyBaseID:FBgn0087008 Length:2012 Species:Drosophila melanogaster
Sequence 2:NP_001278007.1 Gene:Dpf2 / 19708 MGIID:109529 Length:405 Species:Mus musculus


Alignment Length:330 Identity:88/330 - (26%)
Similarity:130/330 - (39%) Gaps:68/330 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1512 ANIPAPPNLLPPR---DYDEAFRNSDYAYPLTVVPDQFSM-AYRQFEPAELRAYPLDTALDK--- 1569
            |:.|..|.|..|.   |.|:..:...     .:..|..|: |..:.:|.|.|..| |..:|.   
Mouse    85 AHPPEDPRLSFPSIKPDTDQTLKKEG-----LISQDGSSLEALLRTDPLEKRGAP-DPRVDDDSL 143

  Fly  1570 ---------------PPTDLMAQLLQAKSEAVGSDEIKTSAPAPKDLGQEQSAIKSVTVTAPVRR 1619
                           .|.|.:..|          |:.......||..|:.:|  ||..|::..::
Mouse   144 GEFPVSNSRARKRIIEPDDFLDDL----------DDEDYEEDTPKRRGKGKS--KSKGVSSARKK 196

  Fly  1620 SRRSTRQQTDKVRTASSS----STSSA-QSVSSASSGN--GSS--------SDTESGDESDFSST 1669
            ...|..:..||.....:|    .||.| |.|......|  |.|        ::.|..|:.|....
Mouse   197 LDASILEDRDKPYACDNSFKQKHTSKAPQRVCGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSRPP 261

  Fly  1670 SSCSSSTGASSGAGSEDEDGNECSSSVRL--STCGVCLRSQHRNAR-DMPEAFIRCYTCRKRVHP 1731
            :..|..        ||::...:....:.|  :.|..||.....|.: ..||..:.|..|.:..||
Mouse   262 TPVSQR--------SEEQKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHP 318

  Fly  1732 SCVDMPPRMVGRVRNYNWQCAGCKCCIKCRSSQRPGKMLYCEQCDRGYHIYCL--GLRTVPDGRW 1794
            ||:...|.|:..|:.|.|||..||||..|.:|:...::|:|:.||||||:|||  .:...|:|.|
Mouse   319 SCLQFTPVMMAAVKTYRWQCIECKCCNLCGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSW 383

  Fly  1795 SCERC 1799
            ||..|
Mouse   384 SCHLC 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)3NP_001259719.1 PHD_SF 1700..1754 CDD:304600 19/54 (35%)
RanBP2-type Zn finger 1700..1725 CDD:275375 7/25 (28%)
RanBP2-type Zn finger 1749..1775 CDD:275375 11/25 (44%)
PHD2_PHF10 1756..1799 CDD:277004 20/44 (45%)
Dpf2NP_001278007.1 Requiem_N 13..79 CDD:290758
PHD1_DPF2_like 286..341 CDD:277161 19/54 (35%)
PHD2_d4 343..388 CDD:277005 20/44 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10615
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.