DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)3 and dpf3

DIOPT Version :9

Sequence 1:NP_001259719.1 Gene:e(y)3 / 32965 FlyBaseID:FBgn0087008 Length:2012 Species:Drosophila melanogaster
Sequence 2:XP_012823348.1 Gene:dpf3 / 100125167 XenbaseID:XB-GENE-6067294 Length:387 Species:Xenopus tropicalis


Alignment Length:308 Identity:75/308 - (24%)
Similarity:114/308 - (37%) Gaps:63/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1555 PAELRAYPLDTALDK----PPTDLMAQLLQAKSEA---VGSDEIKTSAPA-----------PKDL 1601
            |.:|..||......|    ||.|...:||:.||:.   :..|.:......           .||:
 Frog    68 PGQLYTYPARCWRKKRRLHPPEDPRLRLLEIKSDVDFPLRKDNVLAEGTTLEALLRGEGIEKKDV 132

  Fly  1602 GQEQSAIK------------------SVTVTAPVRRSRRSTRQQTDKVRTASSSSTSSAQSV--- 1645
            ..|:|..:                  .:....|.|::|...|.:..:.|..:|........|   
 Frog   133 RDEESLQEIQRVLENDENADDANGEDDIEEEVPKRKNRSRGRARGGRRRNDTSLDEHDKPYVCDN 197

  Fly  1646 SSASSGNGSSSD-------------------TESGDESDFSSTSSCSSSTGASSGAGSEDEDGNE 1691
            |.....|..::|                   |...||.........:.|..:.|...:|::...:
 Frog   198 SYKQKHNSKTADKVCGKRYKNRPGLSYHYAHTHLADEEGTDCRDQDTRSPSSPSAIRNENQKPRK 262

  Fly  1692 CSSSVRLST--CGVCLRSQHRNARD-MPEAFIRCYTCRKRVHPSCVDMPPRMVGRVRNYNWQCAG 1753
            .:....||.  |..||.....|.:. .||..:.|..|.:..||:|:.....|...|:.|.|||..
 Frog   263 GTDGAILSNNYCDFCLGDSSINKKSGQPEELVSCADCGRSGHPTCLQFTVNMTEAVKTYQWQCIE 327

  Fly  1754 CKCCIKCRSSQRPGKMLYCEQCDRGYHIYCL--GLRTVPDGRWSCERC 1799
            ||.||.|.:|:...::|:|:.||||||:|||  .:...|:|.|||..|
 Frog   328 CKSCIVCGTSENDEQLLFCDDCDRGYHMYCLIPPMAEPPEGSWSCHLC 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)3NP_001259719.1 PHD_SF 1700..1754 CDD:304600 17/56 (30%)
RanBP2-type Zn finger 1700..1725 CDD:275375 7/27 (26%)
RanBP2-type Zn finger 1749..1775 CDD:275375 11/25 (44%)
PHD2_PHF10 1756..1799 CDD:277004 20/44 (45%)
dpf3XP_012823348.1 Requiem_N 13..84 CDD:290758 5/15 (33%)
PHD1_DPF3 273..329 CDD:277162 17/55 (31%)
PHD2_d4 330..375 CDD:277005 20/44 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10615
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.