DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)3 and dpf1

DIOPT Version :9

Sequence 1:NP_001259719.1 Gene:e(y)3 / 32965 FlyBaseID:FBgn0087008 Length:2012 Species:Drosophila melanogaster
Sequence 2:XP_012823267.1 Gene:dpf1 / 100036731 XenbaseID:XB-GENE-922864 Length:410 Species:Xenopus tropicalis


Alignment Length:101 Identity:42/101 - (41%)
Similarity:54/101 - (53%) Gaps:4/101 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly  1701 CGVCLRSQHRNARDMPEAFIRCYTCRKRVHPSCVDMPPRMVGRVRNYNWQCAGCKCCIKCRSSQR 1765
            |..||....:..  .||..|.|..|.:..||||:.....|...||.|.|||..||.||.|.:|:.
 Frog   297 CDFCLGGAKKTG--CPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCIECKSCILCGTSEN 359

  Fly  1766 PGKMLYCEQCDRGYHIYCLG--LRTVPDGRWSCERC 1799
            ..::|:|:.||||||:|||.  :...|:|.|||..|
 Frog   360 DDQLLFCDDCDRGYHMYCLSPPMSEPPEGSWSCHLC 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)3NP_001259719.1 PHD_SF 1700..1754 CDD:304600 19/52 (37%)
RanBP2-type Zn finger 1700..1725 CDD:275375 7/23 (30%)
RanBP2-type Zn finger 1749..1775 CDD:275375 11/25 (44%)
PHD2_PHF10 1756..1799 CDD:277004 20/44 (45%)
dpf1XP_012823267.1 Requiem_N 35..106 CDD:372894
SFP1 <214..242 CDD:227516
PHD_SF 292..349 CDD:389947 19/53 (36%)
PHD2_d4 350..395 CDD:277005 20/44 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.