DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MKP-4 and LSF2

DIOPT Version :10

Sequence 1:NP_608332.2 Gene:MKP-4 / 32963 FlyBaseID:FBgn0031044 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_566383.1 Gene:LSF2 / 820265 AraportID:AT3G10940 Length:282 Species:Arabidopsis thaliana


Alignment Length:80 Identity:23/80 - (28%)
Similarity:39/80 - (48%) Gaps:7/80 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PRED-----ILQHLEGCVDFISSALAQ-QGNVLVHCYFGVSRSSSTVIAYMMKRHNLDFLPAYEL 155
            |.:|     :...|...|..:..|::: :|.|.|||..|:.|:....||||....:::...||:.
plant   158 PAKDFDPLSLRSQLPKAVSSLEWAVSEGKGRVYVHCSAGLGRAPGVSIAYMYWFCDMNLNTAYDT 222

  Fly   156 VKAKRRFVQPNAGFV 170
            :.:||. ..||.|.:
plant   223 LVSKRP-CGPNKGAI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MKP-4NP_608332.2 DSP 39..175 CDD:350348 23/80 (29%)
LSF2NP_566383.1 DSP_laforin-like 91..238 CDD:350375 23/80 (29%)

Return to query results.
Submit another query.