DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MKP-4 and Dusp18

DIOPT Version :10

Sequence 1:NP_608332.2 Gene:MKP-4 / 32963 FlyBaseID:FBgn0031044 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_776106.1 Gene:Dusp18 / 75219 MGIID:1922469 Length:188 Species:Mus musculus


Alignment Length:137 Identity:43/137 - (31%)
Similarity:71/137 - (51%) Gaps:7/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IDEVDTGLFLGNLTAATHMETLRSFKITHILTLDSVPLPQHILEASFLTTKYIQ--IADMPREDI 101
            :.::...||:.|..||.:...|.|.:||.::.: ||.:.....|    ..:|:|  :.|.|...:
Mouse    20 LSQITKSLFISNGVAANNKLLLSSNQITTVINV-SVEVANTFYE----DIQYVQVPVVDAPVARL 79

  Fly   102 LQHLEGCVDFISSALAQQGNVLVHCYFGVSRSSSTVIAYMMKRHNLDFLPAYELVKAKRRFVQPN 166
            ....:...|.|.|...|:|..|:||..|||||::..:||:||.|.:..:.|:...|:.|..::||
Mouse    80 SNFFDSVADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLMKYHAMSLVDAHTWTKSCRPIIRPN 144

  Fly   167 AGFVSQL 173
            :||..||
Mouse   145 SGFWEQL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MKP-4NP_608332.2 DSP 39..175 CDD:350348 43/137 (31%)
Dusp18NP_776106.1 PTP_DSP_cys 19..176 CDD:475123 43/137 (31%)
Sufficient for mitochondrial localization 95..141 18/45 (40%)

Return to query results.
Submit another query.