DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MKP-4 and Dusp5

DIOPT Version :10

Sequence 1:NP_608332.2 Gene:MKP-4 / 32963 FlyBaseID:FBgn0031044 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001078859.1 Gene:Dusp5 / 240672 MGIID:2685183 Length:384 Species:Mus musculus


Alignment Length:219 Identity:68/219 - (31%)
Similarity:98/219 - (44%) Gaps:31/219 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VLTREDFD-GGPVSIDEVDTGLFLGNLTAATHMETLRSFKITHILTLDSVPLPQHILEA--SFLT 87
            |..|..:| ||||   |:...|:||:...|:..|.|.:..||.:|.:.     :...||  :.|.
Mouse   168 VAYRPAYDQGGPV---EILPFLYLGSAYHASKCEFLANLHITALLNVS-----RRTSEACTTHLH 224

  Fly    88 TKYIQIADMPREDILQHLEGCVDFISSALAQQGNVLVHCYFGVSRSSSTVIAYMMKRHNLDFLPA 152
            .|:|.:.|....||..|.:..:|||.....:.|.|||||..|||||.:..:||:||........|
Mouse   225 YKWIPVEDSHTADISSHFQEAIDFIDCVREEGGKVLVHCEAGVSRSPTICMAYLMKTKQFRLKEA 289

  Fly   153 YELVKAKRRFVQPNAGFVSQL-----KLFRRMGCKIDPNCQRYK-----IHRLRLAGEQM----- 202
            ::.||.:|..|.||.||:.||     ::.........|:||...     |..|:.....|     
Mouse   290 FDYVKQRRSVVSPNFGFMGQLLQYESEILPSTPTLQPPSCQGEAASSTFIGHLQTLSPDMQGTYC 354

  Fly   203 --RKAKILPQSFHSVVRPDPDITR 224
              |.:.:.|...||.|   |::.|
Mouse   355 TFRTSVLAPVPTHSTV---PELHR 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MKP-4NP_608332.2 DSP 39..175 CDD:350348 48/142 (34%)
Dusp5NP_001078859.1 DSP_MapKP 5..140 CDD:238723
DSP_DUSP5 179..316 CDD:350487 50/144 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.