DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MKP-4 and Epm2a

DIOPT Version :10

Sequence 1:NP_608332.2 Gene:MKP-4 / 32963 FlyBaseID:FBgn0031044 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_034276.2 Gene:Epm2a / 13853 MGIID:1341085 Length:330 Species:Mus musculus


Alignment Length:104 Identity:25/104 - (24%)
Similarity:42/104 - (40%) Gaps:18/104 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DMPREDILQHLEGCVDFISSALAQQGNVLVHCYFGVSRSSSTVIAYMMKRH-----NLDFLPAYE 154
            ||..|..:|.|...|..:.:.|.....|.|||..||.||::.|..::   |     ||..:..:.
Mouse   234 DMSTEGRVQMLPQAVCLLHALLENGHTVYVHCNAGVGRSTAAVCGWL---HYVIGWNLRKVQYFI 295

  Fly   155 LVKAKRRFVQPNAGFVSQLKLFRRMGCKIDPNCQRYKIH 193
            :.|....::..:|...:|....::.|          |:|
Mouse   296 MAKRPAVYIDEDALAQAQQDFSQKFG----------KVH 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MKP-4NP_608332.2 DSP 39..175 CDD:350348 22/84 (26%)
Epm2aNP_034276.2 CBM20_laforin 1..128 CDD:99881
DSP_laforin-like 154..311 CDD:350375 21/79 (27%)
Glucan phosphatase signature motif CXAGXGR. /evidence=ECO:0000250|UniProtKB:O95278 265..271 3/5 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.