DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MKP-4 and Dusp6

DIOPT Version :10

Sequence 1:NP_608332.2 Gene:MKP-4 / 32963 FlyBaseID:FBgn0031044 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_446335.1 Gene:Dusp6 / 116663 RGDID:70978 Length:381 Species:Rattus norvegicus


Alignment Length:154 Identity:52/154 - (33%)
Similarity:79/154 - (51%) Gaps:7/154 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DFDGGPVSID------EVDTGLFLGNLTAATHMETLRSFKITHILTLDSVPLPQHILEASFLTTK 89
            |.||.|:|..      |:...|:||....:|:::.|..|.|.:||.: :..||.....|.....|
  Rat   193 DSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNV-TPNLPNLFENAGEFKYK 256

  Fly    90 YIQIADMPREDILQHLEGCVDFISSALAQQGNVLVHCYFGVSRSSSTVIAYMMKRHNLDFLPAYE 154
            .|.|:|...:::.|.....:.||..|..:...|||||..|:|||.:..:||:|::.||....||:
  Rat   257 QIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYD 321

  Fly   155 LVKAKRRFVQPNAGFVSQLKLFRR 178
            :||.|:..:.||..|:.||..|.|
  Rat   322 IVKMKKSNISPNFNFMGQLLDFER 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MKP-4NP_608332.2 DSP 39..175 CDD:350348 45/141 (32%)
Dusp6NP_446335.1 DSP_MapKP 17..147 CDD:238723
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..203 5/9 (56%)
DSP_MKP_classII 207..343 CDD:350414 45/136 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.