DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MKP-4 and Dusp1

DIOPT Version :10

Sequence 1:NP_608332.2 Gene:MKP-4 / 32963 FlyBaseID:FBgn0031044 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_446221.2 Gene:Dusp1 / 114856 RGDID:620897 Length:367 Species:Rattus norvegicus


Alignment Length:154 Identity:50/154 - (32%)
Similarity:78/154 - (50%) Gaps:8/154 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GGPVSIDEVDTGLFLGNLTAATHMETLRSFKITHILTLDSVPLPQHILEASFLTTKYIQIADMPR 98
            ||||   |:.:.|:||:...|:..:.|.:..||.::.: |...|.| .|..: ..|.|.:.|..:
  Rat   172 GGPV---EILSFLYLGSAYHASRKDMLDALGITALINV-SANCPNH-FEGHY-QYKSIPVEDNHK 230

  Fly    99 EDILQHLEGCVDFISSALAQQGNVLVHCYFGVSRSSSTVIAYMMKRHNLDFLPAYELVKAKRRFV 163
            .||.......:|||.|.....|.|.|||..|:|||::..:||:|:.:.:....|:|.||.:|..:
  Rat   231 ADISSWFNEAIDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSII 295

  Fly   164 QPNAGFVSQLKLFRRMGCKIDPNC 187
            .||..|:.||..|...  .:.|:|
  Rat   296 SPNFSFMGQLLQFESQ--VLAPHC 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MKP-4NP_608332.2 DSP 39..175 CDD:350348 43/135 (32%)
Dusp1NP_446221.2 DSP_MapKP 7..136 CDD:238723
DSP_DUSP1 174..324 CDD:350486 48/152 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.