DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and NAT8

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_003951.3 Gene:NAT8 / 9027 HGNCID:18069 Length:227 Species:Homo sapiens


Alignment Length:120 Identity:27/120 - (22%)
Similarity:51/120 - (42%) Gaps:22/120 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PLTETYGLSFYT-------QYLAKWPEYFQLAESPSGQIMGYIMGKV--------EGHLDNWHGH 71
            |.||...::..|       .||::....|.:|||.. :::| ::|.:        |..|..:|  
Human    81 PWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEE-KVVG-MVGALPVDDPTLREKRLQLFH-- 141

  Fly    72 VTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGY 126
               |.|..::||.|:|..|:..:...:..:....|.|........|:.:|.::|:
Human   142 ---LFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGF 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 27/120 (23%)
Acetyltransf_1 51..126 CDD:278980 16/82 (20%)
NAT8NP_003951.3 RimI <101..200 CDD:223532 23/100 (23%)
Acetyltransf_1 113..194 CDD:278980 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.