DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and MAK3

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_015376.1 Gene:MAK3 / 856163 SGDID:S000006255 Length:176 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:38/148 - (25%)
Similarity:69/148 - (46%) Gaps:19/148 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LTETYGLSFYTQYLAKWPEYFQLA-ESPSGQ---IMGYIMGKVEGHLD-NWHGHVTALTVSPDYR 82
            |:|.|.:..|..:|.:|||...:| ::.||.   .:|.|:.|::.|.: ...|::..|.|...||
Yeast    27 LSEPYSIYVYRYFLNQWPELTYIAVDNKSGTPNIPIGCIVCKMDPHRNVRLRGYIGMLAVESTYR 91

  Fly    83 RLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYRTILEYYSGDQDEDAYDM 147
            ..|:|..|:....|..:::....:.|.....|..|:|:|..:|:|..:.:..||.  .:.||:  
Yeast    92 GHGIAKKLVEIAIDKMQREHCDEIMLETEVENSAALNLYEGMGFIRMKRMFRYYL--NEGDAF-- 152

  Fly   148 RKALSRDVNKKSVIPYTQ 165
                      |.::|.|:
Yeast   153 ----------KLILPLTE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 35/132 (27%)
Acetyltransf_1 51..126 CDD:278980 19/78 (24%)
MAK3NP_015376.1 RimI 26..162 CDD:223532 38/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.