DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and AT1G03150

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_563677.1 Gene:AT1G03150 / 839562 AraportID:AT1G03150 Length:174 Species:Arabidopsis thaliana


Alignment Length:173 Identity:113/173 - (65%)
Similarity:135/173 - (78%) Gaps:3/173 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGKVEGHL 65
            |||:|.|:|:||.:|.:||.|.||||:.:|||..|||:||:||.:||.|..::||||||||||..
plant     1 MTTIRRFSCNDLLRFTSVNLDHLTETFNMSFYMTYLARWPDYFHVAEGPGNRVMGYIMGKVEGQG 65

  Fly    66 DNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEK-KRAYFVDLFVRKSNQVAINMYTNLGYIIY 129
            ::|||||||:||||:|||..||..||:.|||||:| .:|||||||||.||..||.||..||||||
plant    66 ESWHGHVTAVTVSPEYRRQQLAKKLMNLLEDISDKIDKAYFVDLFVRASNTPAIKMYEKLGYIIY 130

  Fly   130 RTILEYYSGDQDEDAYDMRKALSRDVNKKSVIPYTQPITMREL 172
            |.:|.||||  :||..||||||||||.||||||..:|||..||
plant   131 RRVLRYYSG--EEDGLDMRKALSRDVEKKSVIPLKRPITPDEL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 96/150 (64%)
Acetyltransf_1 51..126 CDD:278980 50/75 (67%)
AT1G03150NP_563677.1 RimI 1..150 CDD:223532 96/150 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 124 1.000 Domainoid score I1820
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7165
Inparanoid 1 1.050 229 1.000 Inparanoid score I1149
OMA 1 1.010 - - QHG53973
OrthoDB 1 1.010 - - D1355894at2759
OrthoFinder 1 1.000 - - FOG0003186
OrthoInspector 1 1.000 - - oto3001
orthoMCL 1 0.900 - - OOG6_102129
Panther 1 1.100 - - LDO PTHR45910
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3652
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.