DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and Naa60

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_083366.1 Gene:Naa60 / 74763 MGIID:1922013 Length:242 Species:Mus musculus


Alignment Length:161 Identity:36/161 - (22%)
Similarity:66/161 - (40%) Gaps:34/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKW-------PEYFQLAESPSGQIMGYIMGK 60
            :||....||:        |.:....|..|..:|...|       .::|.||.:..|.|:|.|:.:
Mouse    14 SLRLLCHDDI--------DTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAE 70

  Fly    61 VEGH----------------LDNWHGHVTALTVSPDYRRLGLAALLMSFLED---ISEKKRAYFV 106
            ::..                :|....::.:|.|..::|:.|:.:||:..|:|   .:.:.....:
Mouse    71 IKNRTKIHKEDGDILASSFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAI 135

  Fly   107 DLFVRKSNQVAINMYTNLGYIIYRTILEYYS 137
            .|.|..:|..|||.|.|..:..:..:..|||
Mouse   136 YLHVLTTNNTAINFYENRDFRQHHYLPYYYS 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 36/161 (22%)
Acetyltransf_1 51..126 CDD:278980 21/93 (23%)
Naa60NP_083366.1 Acetyltransf_1 23..155 CDD:395465 29/139 (21%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 101..103 1/1 (100%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 109..114 1/4 (25%)
TIM <139..>203 CDD:419668 10/28 (36%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 150..153 1/2 (50%)
Required for homodimerization. /evidence=ECO:0000250|UniProtKB:Q9H7X0 162..173 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.