DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and Naa50

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_036016025.1 Gene:Naa50 / 72117 MGIID:1919367 Length:175 Species:Mus musculus


Alignment Length:152 Identity:40/152 - (26%)
Similarity:68/152 - (44%) Gaps:16/152 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PFTCDDLFKFNNVNFDPLTETYGLSFYTQY-----LAKWPEYFQLAESPSGQIMGYIMGKVEGHL 65
            |.....|.:.|.|.| |:  :|...||...     |||...:..:|       :|.:..:|:...
Mouse    19 PHNIKQLKRLNQVIF-PV--SYNDKFYKDVLEVGELAKLAYFNDIA-------VGAVCCRVDHSQ 73

  Fly    66 DNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAY-FVDLFVRKSNQVAINMYTNLGYIIY 129
            :....::..|.....|||||:...:::.:.:|.||...: .:.|.|:.||:.||:.|...|:.|.
Mouse    74 NQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEII 138

  Fly   130 RTILEYYSGDQDEDAYDMRKAL 151
            .|...||...:..||:.::|.|
Mouse   139 ETKKNYYKRIEPADAHVLQKNL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 39/150 (26%)
Acetyltransf_1 51..126 CDD:278980 18/75 (24%)
Naa50XP_036016025.1 RimI 16..151 CDD:223532 36/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.