DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and nat15

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001076341.1 Gene:nat15 / 570640 ZFINID:ZDB-GENE-041111-143 Length:242 Species:Danio rerio


Alignment Length:173 Identity:39/173 - (22%)
Similarity:69/173 - (39%) Gaps:43/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTLRPFT----------CDDLFKFNNVNFDPLTETYGLSFYTQYLAKW-------PEYFQLAES 48
            ||.:.|.|          |.|       :.|.:....|..|..:|...|       .::|.||.:
Zfish     1 MTDVVPTTALSEIQLRLLCHD-------DIDRIKVLCGEWFPIEYPDSWYHDITSNKKFFSLAAT 58

  Fly    49 PSGQIMGYIMGKVEGH----------------LDNWHGHVTALTVSPDYRRLGLAALLM-SFLED 96
            ..|.|:|.|:.:::..                :|....::.:|.|..::|:.|:.:||: |..|.
Zfish    59 FRGGIVGMIVAEIKSRTKVHKEDGDILASSFPVDTQVAYILSLGVVKEFRKHGIGSLLLDSLKEH 123

  Fly    97 ISEKKRAY--FVDLFVRKSNQVAINMYTNLGYIIYRTILEYYS 137
            ||...:.:  .:.|.|..:|..||:.|.|..:..:..:..|||
Zfish   124 ISTTAQDHCKAIYLHVLTTNNTAIHFYENRDFKQHHYLPYYYS 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 39/173 (23%)
Acetyltransf_1 51..126 CDD:278980 22/93 (24%)
nat15NP_001076341.1 RimI 20..166 CDD:223532 32/152 (21%)
Acetyltransf_1 79..156 CDD:278980 18/76 (24%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 101..103 1/1 (100%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 109..114 1/4 (25%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 150..153 1/2 (50%)
Required for homodimerization. /evidence=ECO:0000250|UniProtKB:Q9H7X0 162..173 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.