DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and nat8l

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001077308.1 Gene:nat8l / 564754 ZFINID:ZDB-GENE-030729-4 Length:282 Species:Danio rerio


Alignment Length:207 Identity:37/207 - (17%)
Similarity:71/207 - (34%) Gaps:62/207 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYF----------------QLAE------SPS 50
            |...::.|..|....:|:::.|:|...::.....|:                .:|:      .|:
Zfish    96 TTQFMYAFLTVMCYVMTKSFTLTFCAPFILMGARYYYSRKVILSYLDCALHTDMADIEAYYMKPT 160

  Fly    51 GQ------IMGYIMGKV--EGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVD 107
            |.      :.|.::|.|  :...|:....:..::|...:|..|:|..|...:.:.:.......|.
Zfish   161 GSCFWVAVLQGQVVGIVAAQSREDDNTVELRRMSVDSHFRGKGIAKALGRRVIEFAMLNNYSAVV 225

  Fly   108 LFVRKSNQVAINMYTNLGYIIYRTILEYYSGDQDEDAYDMRKALSRDVNKKSVIPYTQP-ITMRE 171
            |........|..:|.:||   :|.:      .:.||                   ||.| :|...
Zfish   226 LGTTAVKMAAHKLYESLG---FRRV------GETED-------------------YTLPGMTRSP 262

  Fly   172 LRR---QMRHDH 180
            |.|   |:|:.|
Zfish   263 LERLFFQIRYSH 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 28/172 (16%)
Acetyltransf_1 51..126 CDD:278980 15/82 (18%)
nat8lNP_001077308.1 Acetyltransf_1 171..245 CDD:278980 15/76 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.