Sequence 1: | NP_001259714.1 | Gene: | Naa20A / 32962 | FlyBaseID: | FBgn0031043 | Length: | 180 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001077308.1 | Gene: | nat8l / 564754 | ZFINID: | ZDB-GENE-030729-4 | Length: | 282 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 37/207 - (17%) |
---|---|---|---|
Similarity: | 71/207 - (34%) | Gaps: | 62/207 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 TCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYF----------------QLAE------SPS 50
Fly 51 GQ------IMGYIMGKV--EGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVD 107
Fly 108 LFVRKSNQVAINMYTNLGYIIYRTILEYYSGDQDEDAYDMRKALSRDVNKKSVIPYTQP-ITMRE 171
Fly 172 LRR---QMRHDH 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Naa20A | NP_001259714.1 | RimI | 1..151 | CDD:223532 | 28/172 (16%) |
Acetyltransf_1 | 51..126 | CDD:278980 | 15/82 (18%) | ||
nat8l | NP_001077308.1 | Acetyltransf_1 | 171..245 | CDD:278980 | 15/76 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0456 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |