DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and kat14

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001002699.2 Gene:kat14 / 562636 ZFINID:ZDB-GENE-040718-452 Length:782 Species:Danio rerio


Alignment Length:154 Identity:31/154 - (20%)
Similarity:57/154 - (37%) Gaps:45/154 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CDDLFKFNNVNFDPLTETYGLSFYTQYLAKWP--EYFQLAESPSGQIM----------GYIMGKV 61
            |.|:|                         ||  :..:..:.|...::          |:::..|
Zfish   655 CQDIF-------------------------WPGIDLSECLQYPDFSVVVLYKKVVIGFGFMVPDV 694

  Fly    62 EGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGY 126
            :.:    ..:::.|.|.|::||.|:|..::..|......|.   |.|.|..||. |:.:|...|:
Zfish   695 KYN----EAYISFLLVHPEWRRAGIATFMIYHLIQTCMGKD---VTLHVSASNS-AMLLYQKFGF 751

  Fly   127 IIYRTILEYYSGDQDEDAYDMRKA 150
            .....||::|......|:.:.|.|
Zfish   752 KTEEYILDFYDKYYPVDSKECRHA 775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 31/154 (20%)
Acetyltransf_1 51..126 CDD:278980 18/84 (21%)
kat14NP_001002699.2 PHD_SF 65..110 CDD:304600
RimI <670..763 CDD:223532 23/100 (23%)
Acetyltransf_1 683..752 CDD:278980 19/76 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.