DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and san

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster


Alignment Length:158 Identity:45/158 - (28%)
Similarity:71/158 - (44%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGY----IMGKVEGHLD 66
            |.....|.|.|.|.| |:  :|...||...|    |..:||:      :.|    ::|.|...:|
  Fly    13 PHNIKQLKKLNTVVF-PV--SYNDKFYVDVL----EAGELAK------LAYYNDIVVGAVCCRID 64

  Fly    67 NWHGH-----VTALTVSPDYRRLGLAALLMSFLEDISEKKRAY-FVDLFVRKSNQVAINMYTNLG 125
            |....     :|...:|| |||||:..::...:.:.:||...: .:.|.|:.:|..||..|...|
  Fly    65 NTENQRRLYIMTLGCLSP-YRRLGIGTVMFEHIMNFAEKDGNFDSIFLHVQINNNGAIEFYKKFG 128

  Fly   126 YIIYRTILEYYSGDQDEDAYDMRKALSR 153
            :.|..|..:||...:..||:.::|.|.|
  Fly   129 FEIVDTKEQYYKRIEPADAHVLQKTLRR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 43/154 (28%)
Acetyltransf_1 51..126 CDD:278980 21/84 (25%)
sanNP_524779.1 RimI <27..145 CDD:223532 35/131 (27%)
Acetyltransf_1 50..130 CDD:278980 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466541
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.