DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa20A and vnc

DIOPT Version :9

Sequence 1:NP_001259714.1 Gene:Naa20A / 32962 FlyBaseID:FBgn0031043 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_648378.1 Gene:vnc / 39175 FlyBaseID:FBgn0263251 Length:196 Species:Drosophila melanogaster


Alignment Length:178 Identity:61/178 - (34%)
Similarity:93/178 - (52%) Gaps:9/178 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGKV---EGHLDNWHGH 71
            :||....:.|...|.|.|.:.:|..:...||:...:|....|.|:||::.|:   |.:.::.|||
  Fly     9 EDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKGAIVGYVLAKMEEPEPNEESRHGH 73

  Fly    72 VTALTVSPDYRRLGLAALLMS-FLEDISEKKRAYFVDLFVRKSNQVAINMYTN-LGYIIYRTILE 134
            :|:|.|...|||||||..||: ..:.:.|...|.:|.|.|||||:.|:|:||| |.:.|.....:
  Fly    74 ITSLAVKRSYRRLGLAQKLMNQASQAMVECFNAQYVSLHVRKSNRAALNLYTNALKFKIIEVEPK 138

  Fly   135 YYSGDQDEDAYDMRKALSR--DVNKKSVIPYTQPITMRELRRQMRHDH 180
            ||:  ..||||.||:.||.  |.::......:.....:.:.|...|.|
  Fly   139 YYA--DGEDAYAMRRDLSEFADEDQAKAAKQSGEEEEKAVHRSGGHGH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa20ANP_001259714.1 RimI 1..151 CDD:223532 55/145 (38%)
Acetyltransf_1 51..126 CDD:278980 36/79 (46%)
vncNP_648378.1 RimI 1..151 CDD:223532 54/143 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466538
Domainoid 1 1.000 41 1.000 Domainoid score I768
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.